ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

387

Name

RHOA

Synonym

ARH12|ARHA|RHO12|RHOH12;ras homolog family member A;RHOA;ras homolog family member A

Definition

Aplysia ras-related homolog 12|h12|oncogene RHO H12|ras homolog gene family, member A|rho cDNA clone 12|small GTP binding protein RhoA|transforming protein RhoA

Position

3p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Sema4D mediated inhibition of cell attachment and migration;PID Reactome;500073

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Lissencephaly gene (LIS1) in neuronal migration and development;PID Curated;200114

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

S1P4 pathway;PID Curated;200043

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Pathway

ccr3 signaling in eosinophils;PID BioCarta;100215

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

rho-selective guanine exchange factor akap13 mediates stress fiber formation;PID BioCarta;100248

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

G beta:gamma signalling through PI3Kgamma;PID Reactome;500439

Pathway

ucalpain and friends in cell spread;PID BioCarta;100008

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

d4gdi signaling pathway;PID BioCarta;100191

Pathway

thrombin signaling and protease-activated receptors;PID BioCarta;100082

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

PI3K/AKT signalling;PID Reactome;500639

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

trefoil factors initiate mucosal healing;PID BioCarta;100018

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

S1P1 pathway;PID Curated;200071

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

S1P2 pathway;PID Curated;200181

Pathway

Endogenous TLR signaling;PID Curated;200177

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Hemostasis;Reactome;REACT:604

Pathway

role of mal in rho-mediated activation of srf;PID BioCarta;100114

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

Aurora B signaling;PID Curated;200010

Pathway

Axonal growth stimulation;PID Reactome;500618

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

protein kinase a at the centrosome;PID BioCarta;100246

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

rho cell motility signaling pathway;PID BioCarta;100041

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Arf6 downstream pathway;PID Curated;200079

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

S1P5 pathway;PID Curated;200063

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Axonal growth inhibition (RHOA activation);PID Reactome;500619

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Hamman-Rich syndrome;FunDO

Disease

IGA glomerulonephritis;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Cancer;FunDO

Disease

Labor, Premature;FunDO

Disease

Vaccinia;FunDO

External Links

Links to cell senescence gene database

387

Links to epithelial mesenchymal transition gene database

387

Links to ovarian cancer gene database

387

Links to endometrial cancer gene database

387

Links to iHOP

387

Sequence Information

Nucleotide Sequence

>387 : length: 1926
GTGGATGAGCTGTGAGTGCGCGCGCGTGCGCGGGGCCGCGACCTGTGCCGGCTCGAGCCC
GCTGGGCACTCGGAGGCGCGCACGTCGTTCCCCGCCCTCCCGCCGCCGCCCGCCCTCGCT
CTCTCGCGCTACCCTCCCGCCGCCCGCGGTCCTCCGTCGGTTCTCTCGTTAGTCCACGGT
CTGGTCTTCAGCTACCCGCCTTCGTCTCCGAGTTTGCGACTCGCGGACCGGCGTCCCCGG
CGCGAAGAGGCTGGACTCGGATTCGTTGCCTGAGCAATGGCTGCCATCCGGAAGAAACTG
GTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGAC
CAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTG
GATGGAAAGCAGGTAGAGTTGGCTTTGTGGGACACAGCTGGGCAGGAAGATTATGATCGC
CTGAGGCCCCTCTCCTACCCAGATACCGATGTTATACTGATGTGTTTTTCCATCGACAGC
CCTGATAGTTTAGAAAACATCCCAGAAAAGTGGACCCCAGAAGTCAAGCATTTCTGTCCC
AACGTGCCCATCATCCTGGTTGGGAATAAGAAGGATCTTCGGAATGATGAGCACACAAGG
CGGGAGCTAGCCAAGATGAAGCAGGAGCCGGTGAAACCTGAAGAAGGCAGAGATATGGCA
AACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCAGCAAAGACCAAAGATGGAGTGAGA
GAGGTTTTTGAAATGGCTACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAAATCT
GGGTGCCTTGTCTTGTGAAACCTTGCTGCAAGCACAGCCCTTATGCGGTTAATTTTGAAG
TGCTGTTTATTAATCTTAGTGTATGATTACTGGCCTTTTTCATTTATCTATAATTTACCT
AAGATTACAAATCAGAAGTCATCTTGCTACCAGTATTTAGAAGCCAACTATGATTATTAA
CGATGTCCAACCCGTCTGGCCCACCAGGGTCCTTTTGACACTGCTCTAACAGCCCTCCTC
TGCACTCCCACCTGACACACCAGGCGCTAATTCAAGGAATTTCTTAACTTCTTGCTTCTT
TCTAGAAAGAGAAACAGTTGGTAACTTTTGTGAATTAGGCTGTAACTACTTTATAACTAA
CATGTCCTGCCTATTATCTGTCAGCTGCAAGGTACTCTGGTGAGTCACCACTTCAGGGCT
TTACTCCGTAACAGATTTTGTTGGCATAGCTCTGGGGTGGGCAGTTTTTTGAAAATGGGC
TCAACCAGAAAAGCCCAAGTTCATGCAGCTGTGGCAGAGTTACAGTTCTGTGGTTTCATG
TTAGTTACCTTATAGTTACTGTGTAATTAGTGCCACTTAATGTATGTTACCAAAAATAAA
TATATCTACCCCAGACTAGATGTAGTATTTTTTGTATAATTGGATTTCCTAATACTGTCA
TCCTCAAAGAAAGTGTATTGGTTTTTTAAAAAAGAAAGTGTATTTGGAAATAAAGTCAGA
TGGAAAATTCATTTTTTAAATTCCCGTTTTGTCACTTTTTCTGATAAAAGATGGCCATAT
TACCCCTTTTCGGCCCCATGTATCTCAGTACCCCATGGAGCTGGGCTAAGTAAATAGGAA
TTGGTTTCACGCCTGAGGCAATTAGACACTTTGGAAGATGGCATAACCTGTCTCACCTGG
ACTTAAGCATCTGGCTCTAATTCACAGTGCTCTTTTCTCCTCACTGTATCCAGGTTCCCT
CCCAGAGGAGCCACCAGTTCTCATGGGTGGCACTCAGTCTCTCTTCTCTCCAGCTGACTA
AACTTTTTTTCTGTACCAGTTAATTTTTCCAACTACTAATAGAATAAAGGCAGTTTTCTA
AAAAAA

Protein Sequence

>387 : length: 193
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL