ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3845

Name

KRAS

Synonym

C-K-RAS|CFC2|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|KI-RAS|KRAS1|KRAS2|NS|NS3|RASK2;Kirsten rat sarcoma viral oncogene homolog;KRAS;Kirsten rat sarcoma viral oncogene homolog

Definition

GTPase KRas|K-Ras 2|K-ras p21 protein|PR310 c-K-ras oncogene|c-Ki-ras|c-Kirsten-ras protein|cellular c-Ki-ras2 proto-oncogene|oncogene KRAS2|transforming protein p21|v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog

Position

12p12.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

telomeres telomerase cellular aging and immortality;PID BioCarta;100021

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

T cell activation;PANTHER;P00053

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

Long-term potentiation;KEGG PATHWAY;hsa04720

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Dorso-ventral axis formation;KEGG PATHWAY;hsa04320

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Colorectal cancer;KEGG DISEASE;H00020

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Cholangiocarcinoma;KEGG DISEASE;H00046

Disease

leukemia, myeloid;GAD

Disease

vinyl chloride exposure;GAD

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Pancreatic cancer;KEGG DISEASE;H00019

Disease

Pancreatic carcinoma, somatic;OMIM

Disease

lung adenocarcinoma;GAD

Disease

Cancer;FunDO

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Bladder cancer;OMIM

Disease

Kaposi's sarcoma;KEGG DISEASE;H00041

Disease

colon cancer;GAD

Disease

Mouth Neoplasms;GAD

Disease

Multiple myeloma;KEGG DISEASE;H00010

Disease

Skin cancers;KEGG DISEASE

Disease

Pancreatitis;FunDO

Disease

lung cancer;GAD

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

PHARMACOGENOMIC;GAD

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

Polycystic ovary syndrome;FunDO

Disease

Carcinoma, Squamous Cell;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Breast cancer, somatic;OMIM

Disease

Viral infections;KEGG DISEASE

Disease

breast cancer colorectal cancer stomach cancer;GAD

Disease

colorectal cancer;GAD

Disease

smoking;GAD

Disease

esophageal cancer;GAD

Disease

Non-small cell lung cancer;KEGG DISEASE;H00014

Disease

Penile disease;FunDO

Disease

Stomach cancer;OMIM

Disease

Hepatocellular carcinoma;KEGG DISEASE;H00048

Disease

Ovarian cancer;KEGG DISEASE;H00027

Disease

Testicular dysfunction;FunDO

Disease

Endometrial cancer;KEGG DISEASE;H00026

Disease

mucinous ovarian tumor;GAD

Disease

Infections caused by dsDNA viruses;KEGG DISEASE

Disease

Cardiofaciocutaneous syndrome;OMIM

Disease

Squamous cell carcinoma;KEGG DISEASE;H00040

Disease

Endometriosis;FunDO

Disease

Gallbladder cancer;KEGG DISEASE;H00047

Disease

Cancers;KEGG DISEASE

Disease

decreased apoptosis.;GAD

Disease

Cervical cancer;KEGG DISEASE;H00030

Disease

Acute myeloid leukemia (AML);KEGG DISEASE;H00003

Disease

Leukemia, acute myelogenous;OMIM

Disease

pancreatic carcinoma;GAD

Disease

CANCER;GAD

Disease

Lung cancer;OMIM

Disease

Oral cancer;KEGG DISEASE;H00016

Disease

Head and neck cancers;KEGG DISEASE

Disease

Noonan syndrome 3;OMIM

External Links

Links to cell senescence gene database

3845

Links to epithelial mesenchymal transition gene database

3845

Links to ovarian cancer gene database

3845

Links to endometrial cancer gene database

3845

Links to iHOP

3845

Sequence Information

Nucleotide Sequence

>3845 : length: 5889
TCCTAGGCGGCGGCCGCGGCGGCGGAGGCAGCAGCGGCGGCGGCAGTGGCGGCGGCGAAG
GTGGCGGCGGCTCGGCCAGTACTCCCGGCCCCCGCCATTTCGGACTGGGAGCGAGCGCGG
CGCAGGCACTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGGAGAGA
GGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAG
AGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGACGAATATGATCCAACAATA
GAGGATTCCTACAGGAAGCAAGTAGTAATTGATGGAGAAACCTGTCTCTTGGATATTCTC
GACACAGCAGGTCAAGAGGAGTACAGTGCAATGAGGGACCAGTACATGAGGACTGGGGAG
GGCTTTCTTTGTGTATTTGCCATAAATAATACTAAATCATTTGAAGATATTCACCATTAT
AGAGAACAAATTAAAAGAGTTAAGGACTCTGAAGATGTACCTATGGTCCTAGTAGGAAAT
AAATGTGATTTGCCTTCTAGAACAGTAGACACAAAACAGGCTCAGGACTTAGCAAGAAGT
TATGGAATTCCTTTTATTGAAACATCAGCAAAGACAAGACAGAGAGTGGAGGATGCTTTT
TATACATTGGTGAGGGAGATCCGACAATACAGATTGAAAAAAATCAGCAAAGAAGAAAAG
ACTCCTGGCTGTGTGAAAATTAAAAAATGCATTATAATGTAATCTGGGTGTTGATGATGC
CTTCTATACATTAGTTCGAGAAATTCGAAAACATAAAGAAAAGATGAGCAAAGATGGTAA
AAAGAAGAAAAAGAAGTCAAAGACAAAGTGTGTAATTATGTAAATACAATTTGTACTTTT
TTCTTAAGGCATACTAGTACAAGTGGTAATTTTTGTACATTACACTAAATTATTAGCATT
TGTTTTAGCATTACCTAATTTTTTTCCTGCTCCATGCAGACTGTTAGCTTTTACCTTAAA
TGCTTATTTTAAAATGACAGTGGAAGTTTTTTTTTCCTCTAAGTGCCAGTATTCCCAGAG
TTTTGGTTTTTGAACTAGCAATGCCTGTGAAAAAGAAACTGAATACCTAAGATTTCTGTC
TTGGGGTTTTTGGTGCATGCAGTTGATTACTTCTTATTTTTCTTACCAATTGTGAATGTT
GGTGTGAAACAAATTAATGAAGCTTTTGAATCATCCCTATTCTGTGTTTTATCTAGTCAC
ATAAATGGATTAATTACTAATTTCAGTTGAGACCTTCTAATTGGTTTTTACTGAAACATT
GAGGGAACACAAATTTATGGGCTTCCTGATGATGATTCTTCTAGGCATCATGTCCTATAG
TTTGTCATCCCTGATGAATGTAAAGTTACACTGTTCACAAAGGTTTTGTCTCCTTTCCAC
TGCTATTAGTCATGGTCACTCTCCCCAAAATATTATATTTTTTCTATAAAAAGAAAAAAA
TGGAAAAAAATTACAAGGCAATGGAAACTATTATAAGGCCATTTCCTTTTCACATTAGAT
AAATTACTATAAAGACTCCTAATAGCTTTTCCTGTTAAGGCAGACCCAGTATGAAATGGG
GATTATTATAGCAACCATTTTGGGGCTATATTTACATGCTACTAAATTTTTATAATAATT
GAAAAGATTTTAACAAGTATAAAAAATTCTCATAGGAATTAAATGTAGTCTCCCTGTGTC
AGACTGCTCTTTCATAGTATAACTTTAAATCTTTTCTTCAACTTGAGTCTTTGAAGATAG
TTTTAATTCTGCTTGTGACATTAAAAGATTATTTGGGCCAGTTATAGCTTATTAGGTGTT
GAAGAGACCAAGGTTGCAAGGCCAGGCCCTGTGTGAACCTTTGAGCTTTCATAGAGAGTT
TCACAGCATGGACTGTGTCCCCACGGTCATCCAGTGTTGTCATGCATTGGTTAGTCAAAA
TGGGGAGGGACTAGGGCAGTTTGGATAGCTCAACAAGATACAATCTCACTCTGTGGTGGT
CCTGCTGACAAATCAAGAGCATTGCTTTTGTTTCTTAAGAAAACAAACTCTTTTTTAAAA
ATTACTTTTAAATATTAACTCAAAAGTTGAGATTTTGGGGTGGTGGTGTGCCAAGACATT
AATTTTTTTTTTAAACAATGAAGTGAAAAAGTTTTACAATCTCTAGGTTTGGCTAGTTCT
CTTAACACTGGTTAAATTAACATTGCATAAACACTTTTCAAGTCTGATCCATATTTAATA
ATGCTTTAAAATAAAAATAAAAACAATCCTTTTGATAAATTTAAAATGTTACTTATTTTA
AAATAAATGAAGTGAGATGGCATGGTGAGGTGAAAGTATCACTGGACTAGGAAGAAGGTG
ACTTAGGTTCTAGATAGGTGTCTTTTAGGACTCTGATTTTGAGGACATCACTTACTATCC
ATTTCTTCATGTTAAAAGAAGTCATCTCAAACTCTTAGTTTTTTTTTTTTACAACTATGT
AATTTATATTCCATTTACATAAGGATACACTTATTTGTCAAGCTCAGCACAATCTGTAAA
TTTTTAACCTATGTTACACCATCTTCAGTGCCAGTCTTGGGCAAAATTGTGCAAGAGGTG
AAGTTTATATTTGAATATCCATTCTCGTTTTAGGACTCTTCTTCCATATTAGTGTCATCT
TGCCTCCCTACCTTCCACATGCCCCATGACTTGATGCAGTTTTAATACTTGTAATTCCCC
TAACCATAAGATTTACTGCTGCTGTGGATATCTCCATGAAGTTTTCCCACTGAGTCACAT
CAGAAATGCCCTACATCTTATTTCCTCAGGGCTCAAGAGAATCTGACAGATACCATAAAG
GGATTTGACCTAATCACTAATTTTCAGGTGGTGGCTGATGCTTTGAACATCTCTTTGCTG
CCCAATCCATTAGCGACAGTAGGATTTTTCAAACCTGGTATGAATAGACAGAACCCTATC
CAGTGGAAGGAGAATTTAATAAAGATAGTGCTGAAAGAATTCCTTAGGTAATCTATAACT
AGGACTACTCCTGGTAACAGTAATACATTCCATTGTTTTAGTAACCAGAAATCTTCATGC
AATGAAAAATACTTTAATTCATGAAGCTTACTTTTTTTTTTTGGTGTCAGAGTCTCGCTC
TTGTCACCCAGGCTGGAATGCAGTGGCGCCATCTCAGCTCACTGCAACCTCCATCTCCCA
GGTTCAAGCGATTCTCGTGCCTCGGCCTCCTGAGTAGCTGGGATTACAGGCGTGTGCCAC
TACACTCAACTAATTTTTGTATTTTTAGGAGAGACGGGGTTTCACCCTGTTGGCCAGGCT
GGTCTCGAACTCCTGACCTCAAGTGATTCACCCACCTTGGCCTCATAAACCTGTTTTGCA
GAACTCATTTATTCAGCAAATATTTATTGAGTGCCTACCAGATGCCAGTCACCGCACAAG
GCACTGGGTATATGGTATCCCCAAACAAGAGACATAATCCCGGTCCTTAGGTAGTGCTAG
TGTGGTCTGTAATATCTTACTAAGGCCTTTGGTATACGACCCAGAGATAACACGATGCGT
ATTTTAGTTTTGCAAAGAAGGGGTTTGGTCTCTGTGCCAGCTCTATAATTGTTTTGCTAC
GATTCCACTGAAACTCTTCGATCAAGCTACTTTATGTAAATCACTTCATTGTTTTAAAGG
AATAAACTTGATTATATTGTTTTTTTATTTGGCATAACTGTGATTCTTTTAGGACAATTA
CTGTACACATTAAGGTGTATGTCAGATATTCATATTGACCCAAATGTGTAATATTCCAGT
TTTCTCTGCATAAGTAATTAAAATATACTTAAAAATTAATAGTTTTATCTGGGTACAAAT
AAACAGGTGCCTGAACTAGTTCACAGACAAGGAAACTTCTATGTAAAAATCACTATGATT
TCTGAATTGCTATGTGAAACTACAGATCTTTGGAACACTGTTTAGGTAGGGTGTTAAGAC
TTACACAGTACCTCGTTTCTACACAGAGAAAGAAATGGCCATACTTCAGGAACTGCAGTG
CTTATGAGGGGATATTTAGGCCTCTTGAATTTTTGATGTAGATGGGCATTTTTTTAAGGT
AGTGGTTAATTACCTTTATGTGAACTTTGAATGGTTTAACAAAAGATTTGTTTTTGTAGA
GATTTTAAAGGGGGAGAATTCTAGAAATAAATGTTACCTAATTATTACAGCCTTAAAGAC
AAAAATCCTTGTTGAAGTTTTTTTAAAAAAAGCTAAATTACATAGACTTAGGCATTAACA
TGTTTGTGGAAGAATATAGCAGACGTATATTGTATCATTTGAGTGAATGTTCCCAAGTAG
GCATTCTAGGCTCTATTTAACTGAGTCACACTGCATAGGAATTTAGAACCTAACTTTTAT
AGGTTATCAAAACTGTTGTCACCATTGCACAATTTTGTCCTAATATATACATAGAAACTT
TGTGGGGCATGTTAAGTTACAGTTTGCACAAGTTCATCTCATTTGTATTCCATTGATTTT
TTTTTTCTTCTAAACATTTTTTCTTCAAACAGTATATAACTTTTTTTAGGGGATTTTTTT
TTAGACAGCAAAAACTATCTGAAGATTTCCATTTGTCAAAAAGTAATGATTTCTTGATAA
TTGTGTAGTAATGTTTTTTAGAACCCAGCAGTTACCTTAAAGCTGAATTTATATTTAGTA
ACTTCTGTGTTAATACTGGATAGCATGAATTCTGCATTGAGAAACTGAATAGCTGTCATA
AAATGAAACTTTCTTTCTAAAGAAAGATACTCACATGAGTTCTTGAAGAATAGTCATAAC
TAGATTAAGATCTGTGTTTTAGTTTAATAGTTTGAAGTGCCTGTTTGGGATAATGATAGG
TAATTTAGATGAATTTAGGGGAAAAAAAAGTTATCTGCAGATATGTTGAGGGCCCATCTC
TCCCCCCACACCCCCACAGAGCTAACTGGGTTACAGTGTTTTATCCGAAAGTTTCCAATT
CCACTGTCTTGTGTTTTCATGTTGAAAATACTTTTGCATTTTTCCTTTGAGTGCCAATTT
CTTACTAGTACTATTTCTTAATGTAACATGTTTACCTGGAATGTATTTTAACTATTTTTG
TATAGTGTAAACTGAAACATGCACATTTTGTACATTGTGCTTTCTTTTGTGGGACATATG
CAGTGTGATCCAGTTGTTTTCCATCATTTGGTTGCGCTGACCTAGGAATGTTGGTCATAT
CAAACATTAAAAATGACCACTCTTTTAATTGAAATTAACTTTTAAATGTTTATAGGAGTA
TGTGCTGTGAAGTGATCTAAAATTTGTAATATTTTTGTCATGAACTGTACTACTCCTAAT
TATTGTAATGTAATAAAAATAGTTACAGTGACTATGAGTGTGTATTTATTCATGAAATTT
GAACTGTTTGCCCCGAAATGGATATGGAATACTTTATAAGCCATAGACACTATAGTATAC
CAGTGAATCTTTTATGCAGCTTGTTAGAAGTATCCTTTATTTCTAAAAGGTGCTGTGGAT
ATTATGTAAAGGCGTGTTTGCTTAAACTTAAAACCATATTTAGAAGTAGATGCAAAACAA
ATCTGCCTTTATGACAAAAAAATAGGATAACATTATTTATTTATTTCCTTTTATCAAAGA
AGGTAATTGATACACAACAGGTGACTTGGTTTTAGGCCCAAAGGTAGCAGCAGCAACATT
AATAATGGAAATAATTGAATAGTTAGTTATGTATGTTAATGCCAGTCACCAGCAGGCTAT
TTCAAGGTCAGAAGTAATGACTCCATACATATTATTTATTTCTATAACTACATTTAAATC
ATTACCAGG

Protein Sequence

>3845 : length: 189
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM