ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

374897

Name

SBSN

Synonym

UNQ698;suprabasin;SBSN;suprabasin

Definition

HLAR698

Position

19q13.13

Gene Type

protein-coding

External Links

Links to cell senescence gene database

374897

Links to epithelial mesenchymal transition gene database

374897

Links to ovarian cancer gene database

374897

Links to endometrial cancer gene database

374897

Links to iHOP

374897

Sequence Information

Nucleotide Sequence

>374897 : length: 1998
GGGAGAGAGGATAAATAGCAGCGTGGCTTCCCTGGCTCCTCTCTGCATCCTTCCCGACCT
TCCCAGCAATATGCATCTTGCACGTCTGGTCGGCTCCTGCTCCCTCCTTCTGCTACTGGG
GGCCCTGTCTGGATGGGCGGCCAGCGATGACCCCATTGAGAAGGTCATTGAAGGGATCAA
CCGAGGGCTGAGCAATGCAGAGAGAGAGGTGGGCAAGGCCCTGGATGGCATCAACAGTGG
AATCACGCATGCCGGAAGGGAAGTGGAGAAGGTTTTCAACGGACTTAGCAACATGGGGAG
CCACACCGGCAAGGAGTTGGACAAAGGCGTCCAGGGGCTCAACCACGGCATGGACAAGGT
TGCCCATGAGATCAACCATGGTATTGGACAAGCAGGAAAGGAAGCAGAGAAGCTTGGCCA
TGGGGTCAACAACGCTGCTGGACAGGTTGGGAAGGAGGCAGACAAACTGATCCATCATGG
GGTCCATCACGGGGCCAACCAGGCGGGAAGTGAGGCAGGGAAGTTTGGCCAGGGAGTCGA
CAATGCTGCAGGGCAGGCTGGAAATGAGGCTGGGAGGTTTGGCCAGGGAGTCCACCATGC
TGCAGGGCAGGCCGGAAATGAGGCTGGGAGGTTTGGCCAGGGAGTCCACCATGCTGCAGG
GCAGGCCGGAAATGAGGCTGGGAGATTTGGCCAGGGGGCCCACCATGGTCTCAGTGAGGG
CTGGAAGGAGACAGAGAAGTTTGGCCAGGGGATCCACCATGCTGCCGGTCAGGTTGGGAA
GGAGGCAGAGAAGTTTGGCCAGGGGGCCCACCATGCTGCGGGGCAGGCCGGAAATGAGGC
AGGGAGATTTGGCCAGGGGGTCCACCATGGTCTCAGTGAGGGCTGGAAGGAGACAGAGAA
GTTTGGCCAGGGGGTCCACCATACTGCTGGTCAGGTTGGGAAGGAGGCAGAGAAGTTTGG
CCAGGGGGCCCACCATGCTGCGGGGCAGGCCGGAAATGAGGCAGGGAGATTTGGCCAGGG
GGCCCACCATGCTGCGGGGCAGGCCGGAAATGAGGCTGGGAGGTTTGGCCAGGGGGTCCA
CCATGGTCTCAGTGAGGGCTGGAAGGAGACAGAGAAGTTTGGCCAGGGGGTCCACCATGC
TGCCAGTCAGTTTGGGAAGGAAACAGAGAAGCTCGGCCATGGGGTCCACCATGGGGTTAA
TGAGGCCTGGAAGGAAGCAGAGAAGTTTGGCCAGGGTGTCCACCATGCTGCCTCGCAGGT
GGGGAAGGAGGAAGACAGAGTGGTCCAAGGCCTCCATCATGGCGTTAGTCAGGCTGGAAG
GGAGGCGGGGCAGTTTGGCCACGACATTCACCACACAGCAGGGCAGGCTGGGAAAGAGGG
AGACATAGCAGTTCATGGTGTCCAACCTGGGGTCCACGAGGCCGGGAAGGAGGCAGGGCA
GTTTGGCCAGGGAGTTCACCATACCCTTGAACAGGCCGGGAAGGAAGCAGACAAAGCGGT
CCAAGGGTTCCACACTGGGGTCCACCAGGCTGGGAAGGAAGCAGAGAAACTTGGCCAAGG
GGTCAACCATGCTGCTGACCAGGCTGGAAAGGAAGTGGAGAAGCTTGGCCAAGGTGCCCA
CCATGCTGCTGGCCAGGCCGGGAAGGAGCTGCAGAATGCTCATAATGGGGTCAACCAAGC
CAGCAAGGAGGCCAACCAGCTGCTGAATGGCAACCATCAAAGCGGATCTTCCAGCCATCA
AGGAGGGGCCACAACCACGCCGTTAGCCTCTGGGGCCTCGGTCAACACGCCTTTCATCAA
CCTTCCCGCCCTGTGGAGGAGCGTCGCCAACATCATGCCCTAAACTGGCATCCGGCCTTG
CTGGGAGAATAATGTCGCCGTTGTCACATCAGCTGACATGACCTGGAGGGGTTGGGGGTG
GGGGACAGGTTTCTGAAATCCCTGAAGGGGGTTGTACTGGGATTTGTGAATAAACTTGAT
ACACTAAAAAAAAAAAAA

Protein Sequence

>374897 : length: 590
MHLARLVGSCSLLLLLGALSGWAASDDPIEKVIEGINRGLSNAEREVGKALDGINSGITH
AGREVEKVFNGLSNMGSHTGKELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVN
NAAGQVGKEADKLIHHGVHHGANQAGSEAGKFGQGVDNAAGQAGNEAGRFGQGVHHAAGQ
AGNEAGRFGQGVHHAAGQAGNEAGRFGQGAHHGLSEGWKETEKFGQGIHHAAGQVGKEAE
KFGQGAHHAAGQAGNEAGRFGQGVHHGLSEGWKETEKFGQGVHHTAGQVGKEAEKFGQGA
HHAAGQAGNEAGRFGQGAHHAAGQAGNEAGRFGQGVHHGLSEGWKETEKFGQGVHHAASQ
FGKETEKLGHGVHHGVNEAWKEAEKFGQGVHHAASQVGKEEDRVVQGLHHGVSQAGREAG
QFGHDIHHTAGQAGKEGDIAVHGVQPGVHEAGKEAGQFGQGVHHTLEQAGKEADKAVQGF
HTGVHQAGKEAEKLGQGVNHAADQAGKEVEKLGQGAHHAAGQAGKELQNAHNGVNQASKE
ANQLLNGNHQSGSSSHQGGATTTPLASGASVNTPFINLPALWRSVANIMP