ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3728

Name

JUP

Synonym

ARVD12|CTNNG|DP3|DPIII|PDGB|PKGB;junction plakoglobin;JUP;junction plakoglobin

Definition

catenin (cadherin-associated protein), gamma 80kDa|desmoplakin III|desmoplakin-3

Position

17q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

Adherens junctions interactions;PID Reactome;500120

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG DISEASE;H00293

Disease

Circulatory system diseases;KEGG DISEASE

Disease

Arrhythmogenic right ventricular dysplasia, familial, 12;OMIM

Disease

Cardiac diseases;KEGG DISEASE

Disease

Cancer;FunDO

Disease

Skin disease, Genetic;FunDO

Disease

Naxos disease;OMIM

External Links

Links to cell senescence gene database

3728

Links to epithelial mesenchymal transition gene database

3728

Links to ovarian cancer gene database

3728

Links to endometrial cancer gene database

3728

Links to iHOP

3728

Sequence Information

Nucleotide Sequence

>3728 : length: 3508
TGAGTTGCTGCCTTGGCCAGAGTCCGGAGCAGCCGCCGCCCGACCACGCCGAGCTCAGTT
CGCTGTCCGCGCCGGCTCCCACCCCGGCCCGACCCCGACCCGGCCCGGTCAGGCCCCATA
CTCAGTAGCCACGATGGAGGTGATGAACCTGATGGAGCAGCCTATCAAGGTGACTGAGTG
GCAGCAGACATACACCTACGACTCGGGTATCCACTCGGGCGCCAACACCTGCGTGCCCTC
CGTCAGCAGCAAGGGCATCATGGAGGAGGATGAGGCCTGCGGGCGCCAGTACACGCTCAA
GAAAACCACCACTTACACCCAGGGGGTGCCCCCCAGCCAAGGTGATCTGGAGTACCAGAT
GTCCACAACAGCCAGGGCCAAACGGGTGCGGGAGGCCATGTGCCCTGGTGTGTCAGGCGA
GGACAGCTCGCTTCTGCTGGCCACCCAGGTGGAGGGGCAGGCCACCAACCTGCAGCGACT
GGCCGAGCCGTCCCAGCTGCTCAAGTCGGCCATTGTGCATCTCATCAACTACCAGGACGA
TGCCGAGCTGGCCACTCGCGCCCTGCCCGAGCTCACCAAACTGCTCAACGACGAGGACCC
GGTGGTGGTGACCAAGGCGGCCATGATTGTGAACCAGCTGTCGAAGAAGGAGGCGTCGCG
GCGGGCCCTGATGGGCTCGCCCCAGCTGGTGGCCGCTGTCGTGCGTACCATGCAGAATAC
CAGCGACCTGGACACAGCCCGCTGCACCACCAGCATCCTGCACAACCTCTCCCACCACCG
GGAGGGGCTGCTCGCCATCTTCAAGTCGGGTGGCATCCCTGCTCTGGTCCGCATGCTCAG
CTCCCCTGTGGAGTCGGTCCTGTTCTATGCCATCACCACGCTGCACAACCTGCTCCTGTA
CCAGGAGGGCGCCAAGATGGCCGTGCGCCTGGCCGACGGGCTGCAAAAGATGGTGCCCCT
GCTCAACAAGAACAACCCCAAGTTCCTGGCCATCACCACCGACTGCCTGCAGCTCCTGGC
CTACGGCAACCAGGAGAGCAAGCTGATCATCCTGGCCAATGGTGGGCCCCAGGCCCTCGT
GCAGATCATGCGTAACTACAGTTATGAAAAGCTGCTCTGGACCACCAGTCGTGTGCTCAA
GGTGCTATCCGTGTGTCCCAGCAATAAGCCTGCCATTGTGGAGGCTGGTGGGATGCAGGC
CCTGGGCAAGCACCTGACCAGCAACAGCCCCCGCCTGGTGCAGAACTGCCTGTGGACCCT
GCGCAACCTCTCAGATGTGGCCACCAAGCAGGAGGGCCTGGAGAGTGTGCTGAAGATTCT
GGTGAATCAGCTGAGTGTGGATGACGTCAACGTCCTCACCTGTGCCACGGGCACACTCTC
CAACCTGACATGCAACAACAGCAAGAACAAGACGCTGGTGACACAGAACAGCGGTGTGGA
GGCTCTCATCCATGCCATCCTGCGTGCTGGTGACAAGGACGACATCACGGAGCCTGCCGT
CTGCGCTCTGCGCCACCTCACTAGCCGCCACCCTGAGGCCGAGATGGCCCAGAACTCTGT
GCGTCTCAACTATGGCATCCCAGCCATCGTGAAGCTGCTCAACCAGCCCAACCAGTGGCC
ACTGGTCAAGGCAACCATCGGCTTGATCAGGAATCTGGCCCTGTGCCCAGCCAACCATGC
CCCGCTGCAGGAGGCAGCGGTCATCCCCCGCCTCGTCCAACTGCTGGTGAAGGCCCACCA
GGATGCCCAGCGCCACGTAGCTGCAGGCACACAGCAGCCCTACACGGATGGTGTGAGGAT
GGAGGAGATTGTGGAGGGCTGCACCGGAGCACTGCACATCCTCGCCCGGGACCCCATGAA
CCGCATGGAGATCTTCCGGCTCAACACCATTCCCCTGTTTGTGCAGCTCCTGTACTCGTC
GGTGGAGAACATCCAGCGCGTGGCTGCCGGGGTGCTGTGTGAGCTGGCCCAGGACAAGGA
GGCGGCCGACGCCATTGATGCAGAGGGGGCCTCGGCCCCACTCATGGAGTTGCTGCACTC
CCGCAACGAGGGCACTGCCACCTACGCTGCTGCCGTCCTGTTCCGCATCTCCGAGGACAA
GAACCCAGACTACCGGAAGCGCGTGTCCGTGGAGCTCACCAACTCCCTCTTCAAGCATGA
CCCGGCTGCCTGGGAGGCTGCCCAGAGCATGATTCCCATCAATGAGCCCTATGGAGATGA
CATGGATGCCACCTACCGCCCCATGTACTCCAGCGATGTGCCCCTTGACCCGCTGGAGAT
GCACATGGACATGGATGGAGACTACCCCATCGACACCTACAGCGACGGCCTCAGGCCCCC
GTACCCCACTGCAGACCACATGCTGGCCTAGGCGGCCTGGCCCCAGTACGGCCCCCTCTT
TGCAGGCTTTTCCTCCTCTCTAGAACCTCCTTCTGTTGGAGGCCCTCCCATCTCCCCGCT
GAAACCTGCGCTCCTTTTTTGGGGGGATCCTTTGCTGCTGAGCTTCCCCAAGCACGGTGT
GCCCTGGCCTGCCTTCTTCTTGTGTCTTTGGTGGGGATGGGGAGGCCTATTCCTGCTGGC
CCCTTCTGGGGGTGGTGGGCAGGTGACACGGAGTGGCTTGAGCTTCTGGGGATGCAGGTC
CACCGAGCCCCTGACCCCTGTCTGTCCCCGCTCCCCTAACAGGTGCGGTTCCTCATCTGA
GAGGCTCTCCGTGCAGGCGATGGGGCAAGACAGAAAAGTGCCTGAGCTGGGGAAGCCGGG
GTGTAACTTCCTGCTGCACCCTGCGCCTCCAGAGGTCCTCCGTAGGGTCTTTCTTGGGAT
AGTGTTCTGCTCCTGCTTTTCTGTCCTGGGCATGGGTCCAGGGCCTGACACCCCCTCCCC
GCCCCTGTGGCCCTGGCCACTAAAGCTTCAGACTCAAGTACCCATTCTGTTTTCCCCCAG
CAACGCCCCTCCAAACCTCCAGCCTCCCTGTCTCCAGCTGCCTGGGCCCGGAAGGGCTTT
GGTTCCTTCTCTGGGTCTGATTTTCTCACTGAACTCCACCGACCAACTGCCCTAAGCCCC
CAGGGCCTCCAGGGCCCAGGTTCGAGACCCAAACCCCCAAAATCCAAAACTTCTCTTGAA
AAGTTCAGGGACCGTCCAGGGGAGATGGGGAGGAGATATGGAGTGAGTCACCTGCTCCAG
AAGATGCCAGCTTCTCTCTCCAGGGTGCTTAGTTGGCTTTGCCCACCCCTCACTCCCCAG
GGAGCTCTGGGGACAGCTTCCTCACACCCCTGTCCCACCCACACAGCTGCCCTAGCTGAC
CCCGAGAAGTGCTCTTGGCTGACCCCTCTGGTGTGTGGTGAGGGGCTTTCTCTTCCCCTT
CCTGTTTCAGACCCCCCCATTTCCCGCACATGGTGTGGGGGGCTGGGGGAGGTCCAAGCA
GAGTGTTTTATTATTATCGCTTTATGTTTTTGGTTATTGGTTTTTTTGTATAGACCAAAG
CAAAGAAAATAAAAATAACACAGATGCG

Protein Sequence

>3728 : length: 745
MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTT
YTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDM
DGDYPIDTYSDGLRPPYPTADHMLA