ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3727

Name

JUND

Synonym

AP-1;jun D proto-oncogene;JUND;jun D proto-oncogene

Definition

JunD-FL isoform|activator protein 1|transcription factor jun-D

Position

19p13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

fosb gene expression and drug abuse;PID BioCarta;100161

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Disease

Leukemia;FunDO

Disease

Glomerulonephritis;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

3727

Links to epithelial mesenchymal transition gene database

3727

Links to ovarian cancer gene database

3727

Links to endometrial cancer gene database

3727

Links to iHOP

3727

Sequence Information

Nucleotide Sequence

>3727 : length: 1963
GAGGCTATAAGAGGGCGCACAAGTGGCGCGGCGCAGGAGCCGCCGCCAGTGGAGGGCCGG
GCGCTGCGGCCGCGGCCGGGGCGGGCGCAGGGCCGAGCGGACGGGGGGGCGCGGGCCCCC
CGGGAGGCCGCGGCCACTCCCCCCCGGGCCGGCGCGGCGGGGGAGGCGGAGGATGGAAAC
ACCCTTCTACGGCGATGAGGCGCTGAGCGGCCTGGGCGGCGGCGCCAGTGGCAGCGGCGG
CAGCTTCGCGTCCCCGGGCCGCTTGTTCCCCGGGGCGCCCCCGACGGCCGCGGCCGGCAG
CATGATGAAGAAGGACGCGCTGACGCTGAGCCTGAGTGAGCAGGTGGCGGCAGCGCTCAA
GCCTGCGGCCGCGCCGCCTCCTACCCCCCTGCGCGCCGACGGCGCCCCCAGCGCGGCACC
CCCCGACGGCCTGCTCGCCTCTCCCGACCTGGGGCTGCTGAAGCTGGCCTCCCCCGAGCT
CGAGCGCCTCATCATCCAGTCCAACGGGCTGGTCACCACCACGCCGACGAGCTCACAGTT
CCTCTACCCCAAGGTGGCGGCCAGCGAGGAGCAGGAGTTCGCCGAGGGCTTCGTCAAGGC
CCTGGAGGATTTACACAAGCAGAACCAGCTCGGCGCGGGCGCGGCCGCTGCCGCCGCCGC
CGCCGCCGCCGGGGGGCCCTCGGGCACGGCCACGGGCTCCGCGCCCCCCGGCGAGCTGGC
CCCGGCGGCGGCCGCGCCCGAAGCGCCTGTCTACGCGAACCTGAGCAGCTACGCGGGCGG
CGCCGGGGGCGCGGGGGGCGCCGCGACGGTCGCCTTCGCTGCCGAACCTGTGCCCTTCCC
GCCGCCGCCACCCCCAGGCGCGTTGGGGCCGCCGCGCCTGGCTGCGCTCAAGGACGAGCC
ACAGACGGTGCCCGACGTGCCGAGCTTCGGCGAGAGCCCGCCGTTGTCGCCCATCGACAT
GGACACGCAGGAGCGCATCAAGGCGGAGCGCAAGCGGCTGCGCAACCGCATCGCCGCCTC
CAAGTGCCGCAAGCGCAAGCTGGAGCGCATCTCGCGCCTGGAAGAGAAAGTGAAGACCCT
CAAGAGTCAGAACACGGAGCTGGCGTCCACGGCGAGCCTGCTGCGCGAGCAGGTGGCGCA
GCTCAAGCAGAAAGTCCTCAGCCACGTCAACAGCGGCTGCCAGCTGCTGCCCCAGCACCA
GGTGCCCGCGTACTGAGTCCGCGCGCGGGGCGCATGCGCGGCCACCCTCCCCAAGGGGCG
GGCTCGCGGGGGGGTGTCGTGGGCGCCCCGGACTTGGAGAGGGTGCGGCCCTGGGGACCC
CCCCTCCCCGAGTGTGCCCAGGAACTCAGAGAGGGCGCGGCCCCCGGGGATTCCCCCCCC
CCGAGGGTGCCCAGGACTCGACAAGCTGGACCCCCTGCTCCCGGGGGGGCGAGCGCATGA
CCCCCCCGCCCTCGCGCTGCCTCTTTCCCCCGCGCGGCCGCCCCGTGTTGCACAAACCCG
CGCGTCTCGGCTGCCCCTTTGTACACCGCGCCGCGGAAGGGGGCTCCGAGGGGGCGCAGC
CTCAAACCCTGCCTTTCCTTTACTTTTACTTTTTTTTTTTTTTCTTTGGAAGAGAGAAGA
ACAGAGTGTTCGATTCTGCCCTATTTATGTTTCTACTCGGGAACAAACGTTGGTTGTGTG
TGTGTGTGTTTTCTTGTGTTGGTTTTTTAAAGAAATGGGAAGAAGAAAAAAAAATTCTCC
GCCCCTTTCCTCGATCTCGCTCCCCCCTTCGGTTCTTTCGACCGGTCCCCCCTCCCTTTT
TTGTTCTGTTTTGTTTTGTTTTGCTACGAGTCCACATTCCTGTTTGTAATCCTTGGTTCG
CCCGGTTTTCTGTTTTCAGTAAAGTCTCGTTACGCCAGCTCGGCTCTCCGCCTCCTTCTT
CCCCCGCCGGGGCCTGGCGGGCTGGGCGGGGCCTGGTTCGCTT

Protein Sequence

>3727 : length: 347
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY