ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3726

Name

JUNB

Synonym

AP-1;jun B proto-oncogene;JUNB;jun B proto-oncogene

Definition

activator protein 1|transcription factor jun-B

Position

19p13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Calcium signaling in the CD4+ TCR pathway;PID Curated;200159

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

gata3 participate in activating the th2 cytokine genes expression;PID BioCarta;100157

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Disease

Lymphoma;FunDO

Disease

Hodgkin's disease;FunDO

External Links

Links to cell senescence gene database

3726

Links to epithelial mesenchymal transition gene database

3726

Links to ovarian cancer gene database

3726

Links to endometrial cancer gene database

3726

Links to iHOP

3726

Sequence Information

Nucleotide Sequence

>3726 : length: 1832
GAGCGGCCAGGCCAGCCTCGGAGCCAGCAGGGAGCTGGGAGCTGGGGGAAACGACGCCAG
GAAAGCTATCGCGCCAGAGAGGGCGACGGGGGCTCGGGAAGCCTGACAGGGCTTTTGCGC
ACAGCTGCCGGCTGGCTGCTACCCGCCCGCGCCAGCCCCCGAGAACGCGCGACCAGGCAC
CCAGTCCGGTCACCGCAGCGGAGAGCTCGCCGCTCGCTGCAGCGAGGCCCGGAGCGGCCC
CGCAGGGACCCTCCCCAGACCGCCTGGGCCGCCCGGATGTGCACTAAAATGGAACAGCCC
TTCTACCACGACGACTCATACACAGCTACGGGATACGGCCGGGCCCCTGGTGGCCTCTCT
CTACACGACTACAAACTCCTGAAACCGAGCCTGGCGGTCAACCTGGCCGACCCCTACCGG
AGTCTCAAAGCGCCTGGGGCTCGCGGACCCGGCCCAGAGGGCGGCGGTGGCGGCAGCTAC
TTTTCTGGTCAGGGCTCGGACACCGGCGCGTCTCTCAAGCTCGCCTCTTCGGAGCTGGAA
CGCCTGATTGTCCCCAACAGCAACGGCGTGATCACGACGACGCCTACACCCCCGGGACAG
TACTTTTACCCCCGCGGGGGTGGCAGCGGTGGAGGTGCAGGGGGCGCAGGGGGCGGCGTC
ACCGAGGAGCAGGAGGGCTTCGCCGACGGCTTTGTCAAAGCCCTGGACGATCTGCACAAG
ATGAACCACGTGACACCCCCCAACGTGTCCCTGGGCGCTACCGGGGGGCCCCCGGCTGGG
CCCGGGGGCGTCTACGCCGGCCCGGAGCCACCTCCCGTTTACACCAACCTCAGCAGCTAC
TCCCCAGCCTCTGCGTCCTCGGGAGGCGCCGGGGCTGCCGTCGGGACCGGGAGCTCGTAC
CCGACGACCACCATCAGCTACCTCCCACACGCGCCGCCCTTCGCCGGTGGCCACCCGGCG
CAGCTGGGCTTGGGCCGCGGCGCCTCCACCTTCAAGGAGGAACCGCAGACCGTGCCGGAG
GCGCGCAGCCGGGACGCCACGCCGCCGGTGTCCCCCATCAACATGGAAGACCAAGAGCGC
ATCAAAGTGGAGCGCAAGCGGCTGCGGAACCGGCTGGCGGCCACCAAGTGCCGGAAGCGG
AAGCTGGAGCGCATCGCGCGCCTGGAGGACAAGGTGAAGACGCTCAAGGCCGAGAACGCG
GGGCTGTCGAGTACCGCCGGCCTCCTCCGGGAGCAGGTGGCCCAGCTCAAACAGAAGGTC
ATGACCCACGTCAGCAACGGCTGTCAGCTGCTGCTTGGGGTCAAGGGACACGCCTTCTGA
ACGTCCCCTGCCCCTTTACGGACACCCCCTCGCTTGGACGGCTGGGCACACGCCTCCCAC
TGGGGTCCAGGGAGCAGGCGGTGGGCACCCACCCTGGGACCTAGGGGCGCCGCAAACCAC
ACTGGACTCCGGCCCTCCTACCCTGCGCCCAGTCCTTCCACCTCGACGTTTACAAGCCCC
CCCTTCCACTTTTTTTTGTATGTTTTTTTTCTGCTGGAAACAGACTCGATTCATATTGAA
TATAATATATTTGTGTATTTAACAGGGAGGGGAAGAGGGGGCGATCGCGGCGGAGCTGGC
CCCGCCGCCTGGTACTCAAGCCCGCGGGGACATTGGGAAGGGGACCCCCGCCCCCTGCCC
TCCCCTCTCTGCACCGTACTGTGGAAAAGAAACACGCACTTAGTCTCTAAAGAGTTTATT
TTAAGACGTGTTTGTGTTTGTGTGTGTTTGTTCTTTTTATTGAATCTATTTAAGTAAAAA
AAAAATTGGTTCTTTAAAAAAAAAAAAAAAAA

Protein Sequence

>3726 : length: 347
MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP
EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP
VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF