ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3725

Name

JUN

Synonym

AP-1|AP1|c-Jun;jun proto-oncogene;JUN;jun proto-oncogene

Definition

Jun activation domain binding protein|activator protein 1|enhancer-binding protein AP1|jun oncogene|p39|proto-oncogene c-Jun|transcription factor AP-1|v-jun avian sarcoma virus 17 oncogene homolog|v-jun sarcoma virus 17 oncogene homolog

Position

1p32-p31

Gene Type

protein-coding

Pathways and Diseases

Pathway

pertussis toxin-insensitive ccr5 signaling in macrophage;PID BioCarta;100214

Pathway

mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

atm signaling pathway;PID BioCarta;100235

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

Endothelins;PID Curated;200004

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

toll-like receptor pathway;PID BioCarta;100013

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

Huntington disease;PANTHER;P00029

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

tpo signaling pathway;PID BioCarta;100012

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221

Pathway

Nephrin/Neph1 signaling in the kidney podocyte;PID Curated;200132

Pathway

FOXA1 transcription factor network;PID Curated;200194

Pathway

IL12 signaling mediated by STAT4;PID Curated;200197

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

signal transduction through il1r;PID BioCarta;100132

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

B cell activation;PANTHER;P00010

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

mets affect on macrophage differentiation;PID BioCarta;100169

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

the 41bb-dependent immune response;PID BioCarta;100257

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

d4gdi signaling pathway;PID BioCarta;100191

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Signaling mediated by p38-alpha and p38-beta;PID Curated;200154

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

FAS signaling pathway;PANTHER;P00020

Pathway

the information processing pathway at the ifn beta enhancer;PID BioCarta;100079

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

S1P2 pathway;PID Curated;200181

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

nerve growth factor pathway (ngf);PID BioCarta;100096

Pathway

repression of pain sensation by the transcriptional regulator dream;PID BioCarta;100186

Pathway

tnf/stress related signaling;PID BioCarta;100026

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

oxidative stress induced gene expression via nrf2;PID BioCarta;100238

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

calcium signaling by hbx of hepatitis b virus;PID BioCarta;100150

Pathway

PDGFR-alpha signaling pathway;PID Curated;200140

Pathway

Calcium signaling in the CD4+ TCR pathway;PID Curated;200159

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

tsp-1 induced apoptosis in microvascular endothelial cell;PID BioCarta;100010

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Activation of the AP-1 family of transcription factors;PID Reactome;500458

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

JNK signaling in the CD4+ TCR pathway;PID Curated;200129

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

il12 and stat4 dependent signaling pathway in th1 development;PID BioCarta;100133

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

fc epsilon receptor i signaling in mast cells;PID BioCarta;100165

Pathway

cadmium induces dna synthesis and proliferation in macrophages;PID BioCarta;100209

Pathway

Ras Pathway;PANTHER;P04393

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Lupus erythematosus;FunDO

Disease

Vaccinia;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Sicca syndrome;FunDO

Disease

Cognitive performance;GAD

Disease

Hepatitis;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Craniosynostosis;FunDO

Disease

Cancer;FunDO

Disease

NEUROLOGICAL;GAD

Disease

Schizophrenia;FunDO

Disease

Hypertension, Pulmonary;FunDO

Disease

Cognitive performance;NHGRI

External Links

Links to cell senescence gene database

3725

Links to epithelial mesenchymal transition gene database

3725

Links to ovarian cancer gene database

3725

Links to endometrial cancer gene database

3725

Links to iHOP

3725

Sequence Information

Nucleotide Sequence

>3725 : length: 3338
GACATCATGGGCTATTTTTAGGGGTTGACTGGTAGCAGATAAGTGTTGAGCTCGGGCTGG
ATAAGGGCTCAGAGTTGCACTGAGTGTGGCTGAAGCAGCGAGGCGGGAGTGGAGGTGCGC
GGAGTCAGGCAGACAGACAGACACAGCCAGCCAGCCAGGTCGGCAGTATAGTCCGAACTG
CAAATCTTATTTTCTTTTCACCTTCTCTCTAACTGCCCAGAGCTAGCGCCTGTGGCTCCC
GGGCTGGTGTTTCGGGAGTGTCCAGAGAGCCTGGTCTCCAGCCGCCCCCGGGAGGAGAGC
CCTGCTGCCCAGGCGCTGTTGACAGCGGCGGAAAGCAGCGGTACCCACGCGCCCGCCGGG
GGAAGTCGGCGAGCGGCTGCAGCAGCAAAGAACTTTCCCGGCTGGGAGGACCGGAGACAA
GTGGCAGAGTCCCGGAGCGAACTTTTGCAAGCCTTTCCTGCGTCTTAGGCTTCTCCACGG
CGGTAAAGACCAGAAGGCGGCGGAGAGCCACGCAAGAGAAGAAGGACGTGCGCTCAGCTT
CGCTCGCACCGGTTGTTGAACTTGGGCGAGCGCGAGCCGCGGCTGCCGGGCGCCCCCTCC
CCCTAGCAGCGGAGGAGGGGACAAGTCGTCGGAGTCCGGGCGGCCAAGACCCGCCGCCGG
CCGGCCACTGCAGGGTCCGCACTGATCCGCTCCGCGGGGAGAGCCGCTGCTCTGGGAAGT
GAGTTCGCCTGCGGACTCCGAGGAACCGCTGCGCCCGAAGAGCGCTCAGTGAGTGACCGC
GACTTTTCAAAGCCGGGTAGCGCGCGCGAGTCGACAAGTAAGAGTGCGGGAGGCATCTTA
ATTAACCCTGCGCTCCCTGGAGCGAGCTGGTGAGGAGGGCGCAGCGGGGACGACAGCCAG
CGGGTGCGTGCGCTCTTAGAGAAACTTTCCCTGTCAAAGGCTCCGGGGGGCGCGGGTGTC
CCCCGCTTGCCAGAGCCCTGTTGCGGCCCCGAAACTTGTGCGCGCAGCCCAAACTAACCT
CACGTGAAGTGACGGACTGTTCTATGACTGCAAAGATGGAAACGACCTTCTATGACGATG
CCCTCAACGCCTCGTTCCTCCCGTCCGAGAGCGGACCTTATGGCTACAGTAACCCCAAGA
TCCTGAAACAGAGCATGACCCTGAACCTGGCCGACCCAGTGGGGAGCCTGAAGCCGCACC
TCCGCGCCAAGAACTCGGACCTCCTCACCTCGCCCGACGTGGGGCTGCTCAAGCTGGCGT
CGCCCGAGCTGGAGCGCCTGATAATCCAGTCCAGCAACGGGCACATCACCACCACGCCGA
CCCCCACCCAGTTCCTGTGCCCCAAGAACGTGACAGATGAGCAGGAGGGCTTCGCCGAGG
GCTTCGTGCGCGCCCTGGCCGAACTGCACAGCCAGAACACGCTGCCCAGCGTCACGTCGG
CGGCGCAGCCGGTCAACGGGGCAGGCATGGTGGCTCCCGCGGTAGCCTCGGTGGCAGGGG
GCAGCGGCAGCGGCGGCTTCAGCGCCAGCCTGCACAGCGAGCCGCCGGTCTACGCAAACC
TCAGCAACTTCAACCCAGGCGCGCTGAGCAGCGGCGGCGGGGCGCCCTCCTACGGCGCGG
CCGGCCTGGCCTTTCCCGCGCAACCCCAGCAGCAGCAGCAGCCGCCGCACCACCTGCCCC
AGCAGATGCCCGTGCAGCACCCGCGGCTGCAGGCCCTGAAGGAGGAGCCTCAGACAGTGC
CCGAGATGCCCGGCGAGACACCGCCCCTGTCCCCCATCGACATGGAGTCCCAGGAGCGGA
TCAAGGCGGAGAGGAAGCGCATGAGGAACCGCATCGCTGCCTCCAAGTGCCGAAAAAGGA
AGCTGGAGAGAATCGCCCGGCTGGAGGAAAAAGTGAAAACCTTGAAAGCTCAGAACTCGG
AGCTGGCGTCCACGGCCAACATGCTCAGGGAACAGGTGGCACAGCTTAAACAGAAAGTCA
TGAACCACGTTAACAGTGGGTGCCAACTCATGCTAACGCAGCAGTTGCAAACATTTTGAA
GAGAGACCGTCGGGGGCTGAGGGGCAACGAAGAAAAAAAATAACACAGAGAGACAGACTT
GAGAACTTGACAAGTTGCGACGGAGAGAAAAAAGAAGTGTCCGAGAACTAAAGCCAAGGG
TATCCAAGTTGGACTGGGTTGCGTCCTGACGGCGCCCCCAGTGTGCACGAGTGGGAAGGA
CTTGGCGCGCCCTCCCTTGGCGTGGAGCCAGGGAGCGGCCGCCTGCGGGCTGCCCCGCTT
TGCGGACGGGCTGTCCCCGCGCGAACGGAACGTTGGACTTTTCGTTAACATTGACCAAGA
ACTGCATGGACCTAACATTCGATCTCATTCAGTATTAAAGGGGGGAGGGGGAGGGGGTTA
CAAACTGCAATAGAGACTGTAGATTGCTTCTGTAGTACTCCTTAAGAACACAAAGCGGGG
GGAGGGTTGGGGAGGGGCGGCAGGAGGGAGGTTTGTGAGAGCGAGGCTGAGCCTACAGAT
GAACTCTTTCTGGCCTGCCTTCGTTAACTGTGTATGTACATATATATATTTTTTAATTTG
ATGAAAGCTGATTACTGTCAATAAACAGCTTCATGCCTTTGTAAGTTATTTCTTGTTTGT
TTGTTTGGGTATCCTGCCCAGTGTTGTTTGTAAATAAGAGATTTGGAGCACTCTGAGTTT
ACCATTTGTAATAAAGTATATAATTTTTTTATGTTTTGTTTCTGAAAATTCCAGAAAGGA
TATTTAAGAAAATACAATAAACTATTGGAAAGTACTCCCCTAACCTCTTTTCTGCATCAT
CTGTAGATACTAGCTATCTAGGTGGAGTTGAAAGAGTTAAGAATGTCGATTAAAATCACT
CTCAGTGCTTCTTACTATTAAGCAGTAAAAACTGTTCTCTATTAGACTTTAGAAATAAAT
GTACCTGATGTACCTGATGCTATGGTCAGGTTATACTCCTCCTCCCCCAGCTATCTATAT
GGAATTGCTTACCAAAGGATAGTGCGATGTTTCAGGAGGCTGGAGGAAGGGGGGTTGCAG
TGGAGAGGGACAGCCCACTGAGAAGTCAAACATTTCAAAGTTTGGATTGTATCAAGTGGC
ATGTGCTGTGACCATTTATAATGTTAGTAGAAATTTTACAATAGGTGCTTATTCTCAAAG
CAGGAATTGGTGGCAGATTTTACAAAAGATGTATCCTTCCAATTTGGAATCTTCTCTTTG
ACAATTCCTAGATAAAAAGATGGCCTTTGCTTATGAATATTTATAACAGCATTCTTGTCA
CAATAAATGTATTCAAATACCAAAAAAAAAAAAAAAAA

Protein Sequence

>3725 : length: 331
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF