ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3716

Name

JAK1

Synonym

JAK1A|JAK1B|JTK3;Janus kinase 1;JAK1;Janus kinase 1

Definition

tyrosine-protein kinase JAK1

Position

1p32.3-p31.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

ifn gamma signaling pathway;PID BioCarta;100138

Pathway

role of erbb2 in signal transduction and oncology;PID BioCarta;100147

Pathway

il 4 signaling pathway;PID BioCarta;100127

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Interferon-gamma signaling pathway;PANTHER;P00035

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

PDGFR-alpha signaling pathway;PID Curated;200140

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

egf signaling pathway;PID BioCarta;100181

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

ifn alpha signaling pathway;PID BioCarta;100139

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

JAK/STAT signaling pathway;PANTHER;P00038

Pathway

il-10 anti-inflammatory signaling pathway;PID BioCarta;100134

Pathway

Angiogenesis;PANTHER;P00005

Pathway

il 2 signaling pathway;PID BioCarta;100130

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

il22 soluble receptor signaling pathway;PID BioCarta;100131

Pathway

il-7 signal transduction;PID BioCarta;100125

Pathway

il 6 signaling pathway;PID BioCarta;100126

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Disease

Autoimmune disease;FunDO

Disease

Embryoma;FunDO

Disease

Prostate cancer;FunDO

Disease

Infection;FunDO

Disease

Adenovirus infection;FunDO

Disease

Leukemia;FunDO

Disease

Melanoma;FunDO

Disease

Colon cancer;FunDO

External Links

Links to cell senescence gene database

3716

Links to epithelial mesenchymal transition gene database

3716

Links to ovarian cancer gene database

3716

Links to endometrial cancer gene database

3716

Links to iHOP

3716

Sequence Information

Nucleotide Sequence

>3716 : length: 5054
ATCCTGGAGCTGCAGACAGTGCGGGCCTGCGCCCAGTCCCGGCTGTCCTCGCCGCGACCC
CTCCTCAGCCCTGGGCGCGCGCACGCTGGGGCCCCGCGGGGCTGGCCGCCTAGCGAGCCT
GCCGGTCGACCCCAGCCAGCGCAGCGACGGGGCGCTGCCTGGCCCAGGCGCACACGGAAG
TGCGCTTCTCTGAAGTAGCTTTGGAAAGTAGAGAAGAAAATCCAGTTTGCTTCTTGGAGA
ACACTGGACAGCTGAATAAATGCAGTATCTAAATATAAAAGAGGACTGCAATGCCATGGC
TTTCTGTGCTAAAATGAGGAGCTCCAAGAAGACTGAGGTGAACCTGGAGGCCCCTGAGCC
AGGGGTGGAAGTGATCTTCTATCTGTCGGACAGGGAGCCCCTCCGGCTGGGCAGTGGAGA
GTACACAGCAGAGGAACTGTGCATCAGGGCTGCACAGGCATGCCGTATCTCTCCTCTTTG
TCACAACCTCTTTGCCCTGTATGACGAGAACACCAAGCTCTGGTATGCTCCAAATCGCAC
CATCACCGTTGATGACAAGATGTCCCTCCGGCTCCACTACCGGATGAGGTTCTATTTCAC
CAATTGGCATGGAACCAACGACAATGAGCAGTCAGTGTGGCGTCATTCTCCAAAGAAGCA
GAAAAATGGCTACGAGAAAAAAAAGATTCCAGATGCAACCCCTCTCCTTGATGCCAGCTC
ACTGGAGTATCTGTTTGCTCAGGGACAGTATGATTTGGTGAAATGCCTGGCTCCTATTCG
AGACCCCAAGACCGAGCAGGATGGACATGATATTGAGAACGAGTGTCTAGGGATGGCTGT
CCTGGCCATCTCACACTATGCCATGATGAAGAAGATGCAGTTGCCAGAACTGCCCAAGGA
CATCAGCTACAAGCGATATATTCCAGAAACATTGAATAAGTCCATCAGACAGAGGAACCT
TCTCACCAGGATGCGGATAAATAATGTTTTCAAGGATTTCCTAAAGGAATTTAACAACAA
GACCATTTGTGACAGCAGCGTGTCCACGCATGACCTGAAGGTGAAATACTTGGCTACCTT
GGAAACTTTGACAAAACATTACGGTGCTGAAATATTTGAGACTTCCATGTTACTGATTTC
ATCAGAAAATGAGATGAATTGGTTTCATTCGAATGACGGTGGAAACGTTCTCTACTACGA
AGTGATGGTGACTGGGAATCTTGGAATCCAGTGGAGGCATAAACCAAATGTTGTTTCTGT
TGAAAAGGAAAAAAATAAACTGAAGCGGAAAAAACTGGAAAATAAACACAAGAAGGATGA
GGAGAAAAACAAGATCCGGGAAGAGTGGAACAATTTTTCTTACTTCCCTGAAATCACTCA
CATTGTAATAAAGGAGTCTGTGGTCAGCATTAACAAGCAGGACAACAAGAAAATGGAACT
GAAGCTCTCTTCCCACGAGGAGGCCTTGTCCTTTGTGTCCCTGGTAGATGGCTACTTCCG
GCTCACAGCAGATGCCCATCATTACCTCTGCACCGACGTGGCCCCCCCGTTGATCGTCCA
CAACATACAGAATGGCTGTCATGGTCCAATCTGTACAGAATACGCCATCAATAAATTGCG
GCAAGAAGGAAGCGAGGAGGGGATGTACGTGCTGAGGTGGAGCTGCACCGACTTTGACAA
CATCCTCATGACCGTCACCTGCTTTGAGAAGTCTGAGGTGCAGGGTGCCCAGAAGCAGTT
CAAGAACTTTCAGATCGAGGTGCAGAAGGGCCGCTACAGTCTGCACGGTTCGGACCGCAG
CTTCCCCAGCTTGGGAGACCTCATGAGCCACCTCAAGAAGCAGATCCTGCGCACGGATAA
CATCAGCTTCATGCTAAAACGCTGCTGCCAGCCCAAGCCCCGAGAAATCTCCAACCTGCT
GGTGGCTACTAAGAAAGCCCAGGAGTGGCAGCCCGTCTACCCCATGAGCCAGCTGAGTTT
CGATCGGATCCTCAAGAAGGATCTGGTGCAGGGCGAGCACCTTGGGAGAGGCACGAGAAC
ACACATCTATTCTGGGACCCTGATGGATTACAAGGATGACGAAGGAACTTCTGAAGAGAA
GAAGATAAAAGTGATCCTCAAAGTCTTAGACCCCAGCCACAGGGATATTTCCCTGGCCTT
CTTCGAGGCAGCCAGCATGATGAGACAGGTCTCCCACAAACACATCGTGTACCTCTATGG
CGTCTGTGTCCGCGACGTGGAGAATATCATGGTGGAAGAGTTTGTGGAAGGGGGTCCTCT
GGATCTCTTCATGCACCGGAAAAGCGATGTCCTTACCACACCATGGAAATTCAAAGTTGC
CAAACAGCTGGCCAGTGCCCTGAGCTACTTGGAGGATAAAGACCTGGTCCATGGAAATGT
GTGTACTAAAAACCTCCTCCTGGCCCGTGAGGGCATCGACAGTGAGTGTGGCCCATTCAT
CAAGCTCAGTGACCCCGGCATCCCCATTACGGTGCTGTCTAGGCAAGAATGCATTGAACG
AATCCCATGGATTGCTCCTGAGTGTGTTGAGGACTCCAAGAACCTGAGTGTGGCTGCTGA
CAAGTGGAGCTTTGGAACCACGCTCTGGGAAATCTGCTACAATGGCGAGATCCCCTTGAA
AGACAAGACGCTGATTGAGAAAGAGAGATTCTATGAAAGCCGGTGCAGGCCAGTGACACC
ATCATGTAAGGAGCTGGCTGACCTCATGACCCGCTGCATGAACTATGACCCCAATCAGAG
GCCTTTCTTCCGAGCCATCATGAGAGACATTAATAAGCTTGAAGAGCAGAATCCAGATAT
TGTTTCAGAAAAAAAACCAGCAACTGAAGTGGACCCCACACATTTTGAAAAGCGCTTCCT
AAAGAGGATCCGTGACTTGGGAGAGGGCCACTTTGGGAAGGTTGAGCTCTGCAGGTATGA
CCCCGAAGGGGACAATACAGGGGAGCAGGTGGCTGTTAAATCTCTGAAGCCTGAGAGTGG
AGGTAACCACATAGCTGATCTGAAAAAGGAAATCGAGATCTTAAGGAACCTCTATCATGA
GAACATTGTGAAGTACAAAGGAATCTGCACAGAAGACGGAGGAAATGGTATTAAGCTCAT
CATGGAATTTCTGCCTTCGGGAAGCCTTAAGGAATATCTTCCAAAGAATAAGAACAAAAT
AAACCTCAAACAGCAGCTAAAATATGCCGTTCAGATTTGTAAGGGGATGGACTATTTGGG
TTCTCGGCAATACGTTCACCGGGACTTGGCAGCAAGAAATGTCCTTGTTGAGAGTGAACA
CCAAGTGAAAATTGGAGACTTCGGTTTAACCAAAGCAATTGAAACCGATAAGGAGTATTA
CACCGTCAAGGATGACCGGGACAGCCCTGTGTTTTGGTATGCTCCAGAATGTTTAATGCA
ATCTAAATTTTATATTGCCTCTGACGTCTGGTCTTTTGGAGTCACTCTGCATGAGCTGCT
GACTTACTGTGATTCAGATTCTAGTCCCATGGCTTTGTTCCTGAAAATGATAGGCCCAAC
CCATGGCCAGATGACAGTCACAAGACTTGTGAATACGTTAAAAGAAGGAAAACGCCTGCC
GTGCCCACCTAACTGTCCAGATGAGGTTTATCAACTTATGAGGAAATGCTGGGAATTCCA
ACCATCCAATCGGACAAGCTTTCAGAACCTTATTGAAGGATTTGAAGCACTTTTAAAATA
AGAAGCATGAATAACATTTAAATTCCACAGATTATCAAGTCCTTCTCCTGCAACAAATGC
CCAAGTCATTTTTTAAAAATTTCTAATGAAAGAAGTTTGTGTTCTGTCCAAAAAGTCACT
GAACTCATACTTCAGTACATATACATGTATAAGGCACACTGTAGTGCTTAATATGTGTAA
GGACTTCCTCTTTAAATTTGGTACCAGTAACTTAGTGACACATAATGACAACCAAAATAT
TTGAAAGCACTTAAGCACTCCTCCTTGTGGAAAGAATATACCACCATTTCATCTGGCTAG
TTCACCATCACAACTGCATTACCAAAAGGGGATTTTTGAAAACGAGGAGTTGACCAAAAT
AATATCTGAAGATGATTGCTTTTCCCTGCTGCCAGCTGATCTGAAATGTTTTGCTGGCAC
ATTAATCATAGATAAAGAAAGATTGATGGACTTAGCCCTCAAATTTCAGTATCTATACAG
TACTAGACCATGCATTCTTAAAATATTAGATACCAGGTAGTATATATTGTTTCTGTACAA
AAATGACTGTATTCTCTCACCAGTAGGACTTAAACTTTGTTTCTCCAGTGGCTTAGCTCC
TGTTCCTTTGGGTGATCACTAGCACCCATTTTTGAGAAAGCTGGTTCTACATGGGGGGAT
AGCTGTGGAATAGATAATTTGCTGCATGTTAATTCTCAAGAACTAAGCCTGTGCCAGTGC
TTTCCTAAGCAGTATACCTTTAATCAGAACTCATTCCCAGAACCTGGATGCTATTACACA
TGCTTTTAAGAAACGTCAATGTATATCCTTTTATAACTCTACCACTTTGGGGCAAGCTAT
TCCAGCACTGGTTTTGAATGCTGTATGCAACCAGTCTGAATACCACATACGCTGCACTGT
TCTTAGAGGGTTTCCATACTTACCACCGATCTACAAGGGTTGATCCCTGTTTTTACCATC
AATCATCACCCTGTGGTGCAACACTTGAAAGACCCGGCTAGAGGCACTATGGACTTCAGG
ATCCACTAGACAGTTTTCAGTTTGCTTGGAGGTAGCTGGGTAATCAAAAATGTTTAGTCA
TTGATTCAATGTGAACGATTACGGTCTTTATGACCAAGAGTCTGAAAATCTTTTTGTTAT
GCTGTTTAGTATTCGTTTGATATTGTTACTTTTCACCTGTTGAGCCCAAATTCAGGATTG
GTTCAGTGGCAGCAATGAAGTTGCCATTTAAATTTGTTCATAGCCTACATCACCAAGGTC
TCTGTGTCAAACCTGTGGCCACTCTATATGCACTTTGTTTACTCTTTATACAAATAAATA
TACTAAAGACTTTA

Protein Sequence

>3716 : length: 1154
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK