ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3702

Name

ITK

Synonym

EMT|LPFS1|LYK|PSCTK2;IL2-inducible T-cell kinase;ITK;IL2-inducible T-cell kinase

Definition

IL-2-inducible T cell kinase|IL-2-inducible T-cell kinase|T-cell-specific kinase|homolog of mouse T-cell itk/tsk|interleukin-2-inducible T cell kinase|interleukin-2-inducible T-cell kinase|kinase EMT|tyrosine-protein kinase ITK/TSK|tyrosine-protein kinase

Position

5q31-q32

Gene Type

protein-coding

Pathways and Diseases

Pathway

the co-stimulatory signal during t-cell activation;PID BioCarta;100193

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Generation of second messenger molecules;PID Reactome;500481

Pathway

Class I PI3K signaling events;PID Curated;200098

Disease

Lymphoproliferative syndrome, EBV-associated, autosomal, 1;OMIM

Disease

Asthma;FunDO

Disease

HIV infection;FunDO

External Links

Links to cell senescence gene database

3702

Links to epithelial mesenchymal transition gene database

3702

Links to ovarian cancer gene database

3702

Links to endometrial cancer gene database

3702

Links to iHOP

3702

Sequence Information

Nucleotide Sequence

>3702 : length: 4366
TGCATTCTTTGCCCCAAAACTCTTTCCTTTGGTTGTGCTAAGAGGTGATGCCCAAGGTGC
ACCACCTTTCAAGAACTGGATCATGAACAACTTTATCCTCCTGGAAGAACAGCTCATCAA
GAAATCCCAACAAAAGAGAAGAACTTCTCCCTCGAACTTTAAAGTCCGCTTCTTTGTGTT
AACCAAAGCCAGCCTGGCATACTTTGAAGATCGTCATGGGAAGAAGCGCACGCTGAAGGG
GTCCATTGAGCTCTCCCGAATCAAATGTGTTGAGATTGTGAAAAGTGACATCAGCATCCC
ATGCCACTATAAATACCCGTTTCAGGTGGTGCATGACAACTACCTCCTATATGTGTTTGC
TCCAGATCGTGAGAGCCGGCAGCGCTGGGTGCTGGCCCTTAAAGAAGAAACGAGGAATAA
TAACAGTTTGGTGCCTAAATATCATCCTAATTTCTGGATGGATGGGAAGTGGAGGTGCTG
TTCTCAGCTGGAGAAGCTTGCAACAGGCTGTGCCCAATATGATCCAACCAAGAATGCTTC
AAAGAAGCCTCTTCCTCCTACTCCTGAAGACAACAGGCGACCACTTTGGGAACCTGAAGA
AACTGTGGTCATTGCCTTATATGACTACCAAACCAATGATCCTCAGGAACTCGCACTGCG
GCGCAACGAAGAGTACTGCCTGCTGGACAGTTCTGAGATTCACTGGTGGAGAGTCCAGGA
CAGGAATGGGCATGAAGGATATGTACCAAGCAGTTATCTGGTGGAAAAATCTCCAAATAA
TCTGGAAACCTATGAGTGGTACAATAAGAGTATCAGCCGAGACAAAGCTGAAAAACTTCT
TTTGGACACAGGCAAAGAAGGAGCCTTCATGGTAAGGGATTCCAGGACTGCAGGAACATA
CACCGTGTCTGTTTTCACCAAGGCTGTTGTAAGTGAGAACAATCCCTGTATAAAGCATTA
TCACATCAAGGAAACAAATGACAATCCTAAGCGATACTATGTGGCTGAAAAGTATGTGTT
CGATTCCATCCCTCTTCTCATCAACTATCACCAACATAATGGAGGAGGCCTGGTGACTCG
ACTCCGGTATCCAGTTTGTTTTGGGAGGCAGAAAGCCCCAGTTACAGCAGGGCTGAGATA
CGGGAAATGGGTGATCGACCCCTCAGAGCTCACTTTTGTGCAAGAGATTGGCAGTGGGCA
ATTTGGGTTGGTGCATCTGGGCTACTGGCTCAACAAGGACAAGGTGGCTATCAAAACCAT
TCGGGAAGGGGCTATGTCAGAAGAGGACTTCATAGAGGAGGCTGAAGTAATGATGAAACT
CTCTCATCCCAAACTGGTGCAGCTGTATGGGGTGTGCCTGGAGCAGGCCCCCATCTGCCT
GGTGTTTGAGTTCATGGAGCACGGCTGCCTGTCAGATTATCTACGCACCCAGCGGGGACT
TTTTGCTGCAGAGACCCTGCTGGGCATGTGTCTGGATGTGTGTGAGGGCATGGCCTACCT
GGAAGAGGCATGTGTCATCCACAGAGACTTGGCTGCCAGAAATTGTTTGGTGGGAGAAAA
CCAAGTCATCAAGGTGTCTGACTTTGGGATGACAAGGTTCGTTCTGGATGATCAGTACAC
CAGTTCCACAGGCACCAAATTCCCGGTGAAGTGGGCATCCCCAGAGGTTTTCTCTTTCAG
TCGCTATAGCAGCAAGTCCGATGTGTGGTCATTTGGTGTGCTGATGTGGGAAGTTTTCAG
TGAAGGCAAAATCCCGTATGAAAACCGAAGCAACTCAGAGGTGGTGGAAGACATCAGTAC
CGGATTTCGGTTGTACAAGCCCCGGCTGGCCTCCACACACGTCTACCAGATTATGAATCA
CTGCTGGAAAGAGAGACCAGAAGATCGGCCAGCCTTCTCCAGACTGCTGCGTCAACTGGC
TGAAATTGCAGAATCAGGACTTTAGTAGAGACTGAGTACCAGGCCACGGGCTGCAGATCC
TGAATGGAGGAAGGATATGTCCTCATTCCATAGAGCATTAGAAGCTGCCACCAGCCCAGG
ACCCTCCAGAGGCAGCCTGGCCTGTGGCATCAGTCCCTGAGTCACCATGGAAGCAGCATC
CTGACCACAGCTGGCAGTCAAGCCACAGCTGGAGGGTCAGCCACCAAGCTGGGAGCTGAG
CCAGAACAGGAGTGATGTCTCTGCCCTTCCTCTAGCCTCTTGTCACATGTGGTGCACAAA
CCTCAACCTGACAGCTTTCAGACAGCATTCTTGCACTTCTTAGCAACAGAGAGAGACATG
AGTAAGACCCAGATTGCTATTTTTATTGTTATTTTTAACATGAATCTAAAGTTTATGGTT
CCAGGGACTTTTTATTTGACCCAACAACACAGTATCCCAGGATATGGAGGCAAGGGGAAC
AAAGAGCATGAGTCTTTTTCCAAGAAAACTGGTGAGTTAAGTAAGATTAGAGTGAGTGTG
CTCTGTTGCTGTGATGCTGTCAGCCACAGCTTCCTGCCGTAGAGAATGATAGAGCAGCTG
CTCACACAGGAGGCCGGATATTCTGAGAAGCAGCTTTATGAGGTTTTACAGAGTATGCTG
CTACCTCTCTCCTTGAAGGGAGCATGGCGAGACCCATTGGATGGATTGGGGTGAACAGTT
CAGGTCCCATGCTTGGAGCATTGGGTATCTGATGTCTGCACCAGAACAAGAGAACCTCTG
ACGGTGGAGAACCATGTGGTGCAAGAAGAGATCTTAGGTCTCTTCTTTTATACCAAGCTC
ATCTTTTATACCAAGCTGTGCAGGTGACTATGCCTCCTCTTCTGCACAGAATGCTTCCAC
CAGCATCCTGAGAAGAAATGATTACTTCTGAAAAACATCCTTTTTTCCAGCCTCTGGGAA
TCAGCCCCCCCTCTCTGCACTATCCGATCCTCATCAACAGAGGGCAGCATTGTGTTGGTC
AATGTTCCCTTGGCGAGCAATTGAAACTTGTTTAGGCCCTAGGGTTGAGCAATTTTAAGG
TTGAGACTCCAAGTCTCCTAAAATTCTAGGAGAGAAATAAAGAGTCTGTTTTTGCTCAAA
CCATCAGGATGGAAACAGTCAGGCACTGACTGGGGTGCTTCCAAGAGGCATGAGAGTGCC
TACTCTGGCTTGAGCACTTCTATATGCAAGGTGAATATGTACTGAGCTAGGAGACTTCCC
TGCAAAATCTCTGTTCACCCTGGGTTCACATCCCCATGAGGTAATATTATTATTCCCATT
TTACAAATAATGTAACTGAGGCTTTAAAAAGCCAAGACATCTGCCCAAAGTGATGGAACT
AGAAAGTCTAGAGCTGGTATTCTAGCCCAAATCTGTCTGACCGCAATACACAGATTCTTT
ATTCCTATTCGACACTGGCTTCTACTGAAAATGAAACGGATTGCAGAGGGAATAAATACA
AAGATGGAAAGCCAGTAAAGAAGTCAGTATAGAACCACTAGCGAATAGTGTTGCTCTGGC
ACAGACCACTGTGGTTGATGGCATGGCCCTCCAACTTGGAATAGGATTTTCCTTTTCCTA
TTCTGTATCCTTACCTTGGTCATGTTAATGACTTTGGAGTTATTCAGTTAATGACCCTTT
AATTCTCACAACCAACCAGTCATGTTGCTTGAAGCCATTTATAGACGAGCTTCAAAGCAA
CTTTAAAAGATTCTTCTGTAGAAGTATGAGTTCTTCCTTTAATTATCATTCCAACTTTCA
GCTGTAGTCTTCTTGAACACTTCATGAGGAGGGACATTCCCTGATATAAGAGAGGATGGT
GTTGCAATTGGCTCTTTCTAAATCATGTGACGTTTTGACTGGCTTGAGATTCAGATGCAT
AATTTTTAATTATAATTATTGTGAAGTGGAGAGCCTCAAGATAAAACTCTGTCATTCAGA
AGATGATTTTACTCAGCTTATCCAAAATTATCTCTGTTTACTTTTTAGAATTTTGTACAT
TATCTTTTGGGATCCTTAATTAGAGATGATTTCTGGAACATTCAGTCTAGAAAGAAAACA
TTGGAATTGACTGATCTCTGTGGTTTGGTTTAGAAAATTCCCCTGTGCATGGTATTACCT
TTTTCAAGCTCAGATTCATCTAATCCTCAACTGTACATGTGTACATTCTTCACCTCCTGG
TGCCCTATCCCGCAAAATGGGCTTCCTGCCTGGTTTTTCTCTTCTCACATTTTTTAAATG
GTCCCCTGTGTTTGTAGAGAACTCCCTTATACAGAGTTTTGGTTCTAGTTTTATTTCGTA
GATTTTGCATTTTGTACCTTTTGAGACTATGTATTTATATTTGGATCAGATGCATATTTA
TTAATGTACAGTCACTGCTAGTGTTCAAAATAAAAATGTTACAAAT

Protein Sequence

>3702 : length: 620
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL