ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

369

Name

ARAF

Synonym

A-RAF|ARAF1|PKS2|RAFA1;A-Raf proto-oncogene, serine/threonine kinase;ARAF;A-Raf proto-oncogene, serine/threonine kinase

Definition

A-Raf proto-oncogene serine/threonine-protein kinase|Oncogene ARAF1|Ras-binding protein DA-Raf|proto-oncogene A-Raf-1|proto-oncogene Pks|serine/threonine-protein kinase A-Raf|v-raf murine sarcoma 3611 viral oncogene homolog 1

Position

Xp11.4-p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

T cell activation;PANTHER;P00053

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

B cell activation;PANTHER;P00010

Pathway

Long-term potentiation;KEGG PATHWAY;hsa04720

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

External Links

Links to cell senescence gene database

369

Links to epithelial mesenchymal transition gene database

369

Links to ovarian cancer gene database

369

Links to endometrial cancer gene database

369

Links to iHOP

369

Sequence Information

Nucleotide Sequence

>369 : length: 2619
AAAAAAAAAAACAGAAAAAAAAAAAAAAAAAACCCAGGACATTCTGTTCGTGCTTCTTAT
GTACCTGACGGCTCAGTGCAGTGTGTACTGACTTCCCCATTGGTCCCCAGCACAGAGTCT
TGTGTGCTCCTCTACCCTCCAAGACAGTATGCTCTGTCCCCCTTCCCTGTTCTCTCCCCC
GCAACCCTGTGCAGTGAAGCTGAGACCTTGGCACTCAAGAGTGAGACAAGCAACAGGAGG
GCCTGAGCAGAGAAGGAACTGGAAGGACTTCAGATGAGCCCCATGGCACCTGCCCAGCCC
CACCTCAGCCCATCTTGACAAAATCTAAGGCTCCATGGAGCCACCACGGGGCCCCCCTGC
CAATGGGGCCGAGCCATCCCGGGCAGTGGGCACCGTCAAAGTATACCTGCCCAACAAGCA
ACGCACGGTGGTGACTGTCCGGGATGGCATGAGTGTCTACGACTCTCTAGACAAGGCCCT
GAAGGTGCGGGGTCTAAATCAGGACTGCTGTGTGGTCTACCGACTCATCAAGGGACGAAA
GACGGTCACTGCCTGGGACACAGCCATTGCTCCCCTGGATGGCGAGGAGCTCATTGTCGA
GGTCCTTGAAGATGTCCCGCTGACCATGCACAATTTTGTACGGAAGACCTTCTTCAGCCT
GGCGTTCTGTGACTTCTGCCTTAAGTTTCTGTTCCATGGCTTCCGTTGCCAAACCTGTGG
CTACAAGTTCCACCAGCATTGTTCCTCCAAGGTCCCCACAGTCTGTGTTGACATGAGTAC
CAACCGCCAACAGTTCTACCACAGTGTCCAGGATTTGTCCGGAGGCTCCAGACAGCATGA
GGCTCCCTCGAACCGCCCCCTGAATGAGTTGCTAACCCCCCAGGGTCCCAGCCTTTCCCC
TGGCAGCCCCCGCACCCAGCACTGTGACCCGGAGCACTTCCCCTTCCCTGCCCCAGCCAA
TGCCCCCCTACAGCGCATCCGCTCCACGTCCACTCCCAACGTCCATATGGTCAGCACCAC
GGCCCCCATGGACTCCAACCTCATCCAGCTCACTGGCCAGAGTTTCAGCACTGATGCTGC
CGGTAGTAGAGGAGGTAGTGATGGAACCCCCCGGGGGAGCCCCAGCCCAGCCAGCGTGTC
CTCGGGGAGGAAGTCCCCACATTCCAAGTCACCAGCAGAGCAGCGCGAGCGGAAGTCCTT
GGCCGATGACAAGAAGAAAGTGAAGAACCTGGGGTACCGGGACTCAGGCTATTACTGGGA
GGTACCACCCAGTGAGGTGCAGCTGCTGAAGAGGATCGGGACGGGCTCGTTTGGCACCGT
GTTTCGAGGGCGGTGGCATGGCGATGTGGCCGTGAAGGTGCTCAAGGTGTCCCAGCCCAC
AGCTGAGCAGGCCCAGGCTTTCAAGAATGAGATGCAGGTGCTCAGGAAGACGCGACATGT
CAACATCTTGCTGTTTATGGGCTTCATGACCCGGCCGGGATTTGCCATCATCACACAGTG
GTGTGAGGGCTCCAGCCTCTACCATCACCTGCATGTGGCCGACACACGCTTCGACATGGT
CCAGCTCATCGACGTGGCCCGGCAGACTGCCCAGGGCATGGACTACCTCCATGCCAAGAA
CATCATCCACCGAGATCTCAAGTCTAACAACATCTTCCTACATGAGGGGCTCACGGTGAA
GATCGGTGACTTTGGCTTGGCCACAGTGAAGACTCGATGGAGCGGGGCCCAGCCCTTGGA
GCAGCCCTCAGGATCTGTGCTGTGGATGGCAGCTGAGGTGATCCGTATGCAGGACCCGAA
CCCCTACAGCTTCCAGTCAGACGTCTATGCCTACGGGGTTGTGCTCTACGAGCTTATGAC
TGGCTCACTGCCTTACAGCCACATTGGCTGCCGTGACCAGATTATCTTTATGGTGGGCCG
TGGCTATCTGTCCCCGGACCTCAGCAAAATCTCCAGCAACTGCCCCAAGGCCATGCGGCG
CCTGCTGTCTGACTGCCTCAAGTTCCAGCGGGAGGAGCGGCCCCTCTTCCCCCAGATCCT
GGCCACAATTGAGCTGCTGCAACGGTCACTCCCCAAGATTGAGCGGAGTGCCTCGGAACC
CTCCTTGCACCGCACCCAGGCCGATGAGTTGCCTGCCTGCCTACTCAGCGCAGCCCGCCT
TGTGCCTTAGGCCCCGCCCAAGCCACCAGGGAGCCAATCTCAGCCCTCCACGCCAAGGAG
CCTTGCCCACCAGCCAATCAATGTTCGTCTCTGCCCTGATGCTGCCTCAGGATCCCCCAT
TCCCCACCCTGGGAGATGAGGGGGTCCCCATGTGCTTTTCCAGTTCTTCTGGAATTGGGG
GACCCCCGCCAAAGACTGAGCCCCCTGTCTCCTCCATCATTTGGTTTCCTCTTGGCTTTG
GGGATACTTCTAAATTTTGGGAGCTCCTCCATCTCCAATGGCTGGGATTTGTGGCAGGGA
TTCCACTCAGAACCTCTCTGGAATTTGTGCCTGATGTGCCTTCCACTGGATTTTGGGGTT
CCCAGCACCCCATGTGGATTTTGGGGGGTCCCTTTTGTGTCTCCCCCGCCATTCAAGGAC
TCCTCTCTTTCTTCACCAAGAAGCACAGAATTCTGCTGG

Protein Sequence

>369 : length: 611
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELL
TPQGPSLSPGSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLT
GQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLG
YRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEM
QVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQ
GMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAA
EVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKIS
SNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELP
ACLLSAARLVP