ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3675

Name

ITGA3

Synonym

CD49C|GAP-B3|GAPB3|ILNEB|MSK18|VCA-2|VL3A|VLA3a;integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor);ITGA3;integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)

Definition

CD49 antigen-like family member C|FRP-2|VLA-3 subunit alpha|antigen identified by monoclonal antibody J143|galactoprotein B3|integrin alpha-3|very late activation protein 3 receptor, alpha-3 subunit

Position

17q21.33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Dilated cardiomyopathy;KEGG PATHWAY;hsa05414

Pathway

Integrin cell surface interactions;PID Reactome;500004

Pathway

Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

3675

Links to epithelial mesenchymal transition gene database

3675

Links to ovarian cancer gene database

3675

Links to endometrial cancer gene database

3675

Links to iHOP

3675

Sequence Information

Nucleotide Sequence

>3675 : length: 5044
TTTCCCCGGAAGGAAAGCGCAGCCCGGGCTGGGCTCGCAAGGTGGGGAGGTGCGGGACTG
GGCGTGGGGAGGCGGGGCGCGCGCCGGGGGACCCCTCCCTCCTGTCCTCCTTGCGGTCGA
CCGGTGCGCTTGCCAGATCCGCCGCGAAGCCGGGATCGAAGGCGACAGCGCGGCCAAGGG
GGCGCGGCCGGGACAAGCTGGGGGCCGGTTGCCCGGGGCAGGGACGGCGGCGACCCGGCC
GCTGGGGAGGCAGGAAGATAGACCCACGGATCTTAGGAAGGGATCCGAGAGCGCAGCTGT
GAAACTGGCTGGGGCTGGGGGCACGAAACCGATCAGCGCTACGGAGCGCAGCGGCCGGCG
GGTTCCAGTGTCCTCCGGCGGCGCGGGGAGCAGGTGAACAGGTCCTCACGCCCAGCTCCG
CGCCCTCACGCGCTCTCGCCGGGACCCCGCTTCCGCTGGCAGCCATGGGCCCCGGCCCCA
GCCGCGCGCCCCGCGCCCCACGCCTGATGCTCTGTGCGCTCGCCTTGATGGTGGCGGCCG
GCGGCTGCGTCGTCTCCGCCTTCAACCTGGATACCCGATTCCTGGTAGTGAAGGAGGCCG
GGAACCCGGGCAGCCTCTTCGGCTACTCGGTCGCCCTCCATCGGCAGACAGAGCGGCAGC
AGCGCTACCTGCTCCTGGCTGGTGCCCCCCGGGAGCTCGCTGTGCCCGATGGCTACACCA
ACCGGACTGGTGCTGTGTACCTGTGCCCACTCACTGCCCACAAGGATGACTGTGAGCGGA
TGAACATCACAGTGAAAAATGACCCTGGCCATCACATTATTGAGGACATGTGGCTTGGAG
TGACTGTGGCCAGCCAGGGCCCTGCAGGCAGAGTTCTGGTCTGTGCCCACCGCTACACCC
AGGTGCTGTGGTCAGGGTCAGAAGACCAGCGGCGCATGGTGGGCAAGTGCTACGTGCGAG
GCAATGACCTAGAGCTGGACTCCAGTGATGACTGGCAGACCTACCACAACGAGATGTGCA
ATAGCAACACAGACTACCTGGAGACGGGCATGTGCCAGCTGGGCACCAGCGGTGGCTTCA
CCCAGAACACTGTGTACTTCGGCGCCCCCGGTGCCTACAACTGGAAAGGAAACAGCTACA
TGATTCAGCGCAAGGAGTGGGACTTATCTGAGTATAGTTACAAGGACCCAGAGGACCAAG
GAAACCTCTATATTGGGTACACGATGCAGGTAGGCAGCTTCATCCTGCACCCCAAAAACA
TCACCATTGTGACAGGTGCCCCACGGCACCGACATATGGGCGCGGTGTTCTTGCTGAGCC
AGGAGGCAGGCGGAGACCTGCGGAGGAGGCAGGTGCTGGAGGGCTCGCAGGTGGGCGCCT
ATTTTGGCAGCGCCATTGCCCTGGCAGACCTGAACAATGATGGGTGGCAGGACCTCCTGG
TGGGCGCCCCCTACTACTTCGAGAGGAAAGAGGAAGTAGGGGGTGCCATCTATGTCTTCA
TGAACCAGGCGGGAACCTCCTTCCCTGCTCACCCCTCACTCCTTCTTCATGGCCCCAGTG
GCTCTGCCTTTGGTTTATCTGTGGCCAGCATTGGTGACATCAACCAGGATGGATTTCAGG
ATATTGCTGTGGGAGCTCCGTTTGAAGGCTTGGGCAAAGTGTACATCTATCACAGTAGCT
CTAAGGGGCTCCTTAGACAGCCCCAGCAGGTAATCCATGGAGAGAAGCTGGGACTGCCTG
GGTTGGCCACCTTCGGCTATTCCCTCAGTGGGCAGATGGATGTGGATGAGAACTTCTACC
CAGACCTTCTAGTGGGAAGCCTGTCAGACCACATTGTGCTGCTGCGGGCCCGGCCCGTCA
TCAACATCGTCCACAAGACCTTGGTGCCCAGGCCAGCTGTGCTGGACCCTGCACTTTGCA
CGGCCACCTCTTGTGTGCAAGTGGAGCTGTGCTTTGCTTACAACCAGAGTGCCGGGAACC
CCAACTACAGGCGAAACATCACCCTGGCCTACACTCTGGAGGCTGACAGGGACCGCCGGC
CGCCCCGGCTCCGCTTTGCCGGCAGTGAGTCCGCTGTCTTCCACGGCTTCTTCTCCATGC
CCGAGATGCGCTGCCAGAAGCTGGAGCTGCTCCTGATGGACAACCTCCGTGACAAACTCC
GCCCCATCATCATCTCCATGAACTACTCTTTACCTTTGCGGATGCCCGATCGCCCCCGGC
TGGGGCTGCGGTCCCTGGACGCCTACCCGATCCTCAACCAGGCACAGGCTCTGGAGAACC
ACACTGAGGTCCAGTTCCAGAAGGAGTGCGGGCCTGACAACAAGTGTGAGAGCAACTTGC
AGATGCGGGCAGCCTTCGTGTCAGAGCAGCAGCAGAAGCTGAGCAGGCTCCAGTACAGCA
GAGACGTCCGGAAATTGCTCCTGAGCATCAACGTGACGAACACCCGGACCTCGGAGCGCT
CCGGGGAGGACGCCCACGAGGCGCTGCTCACCCTGGTGGTGCCTCCCGCCCTGCTGCTGT
CCTCAGTGCGCCCCCCCGGGGCCTGCCAAGCTAATGAGACCATCTTTTGCGAGCTGGGGA
ACCCCTTCAAACGGAACCAGAGGATGGAGCTGCTCATCGCCTTTGAGGTCATCGGGGTGA
CCCTGCACACAAGGGACCTTCAGGTGCAGCTGCAGCTCTCCACGTCGAGTCACCAGGACA
ACCTGTGGCCCATGATCCTCACTCTGCTGGTGGACTATACACTCCAGACCTCGCTTAGCA
TGGTAAATCACCGGCTACAAAGCTTCTTTGGGGGGACAGTGATGGGTGAGTCTGGCATGA
AAACTGTGGAGGATGTAGGAAGCCCCCTCAAGTATGAATTCCAGGTGGGCCCAATGGGGG
AGGGGCTGGTGGGCCTGGGGACCCTGGTCCTAGGTCTGGAGTGGCCCTACGAAGTCAGCA
ATGGCAAGTGGCTGCTGTATCCCACGGAGATCACCGTCCATGGCAATGGGTCCTGGCCCT
GCCGACCACCTGGAGACCTTATCAACCCTCTCAACCTCACTCTTTCTGACCCTGGGGACA
GGCCATCATCCCCACAGCGCAGGCGGCGACAGCTGGATCCAGGGGGAGGCCAGGGCCCCC
CACCTGTCACTCTGGCTGCTGCCAAAAAAGCCAAGTCTGAGACTGTGCTGACCTGTGCCA
CAGGGCGTGCCCACTGTGTGTGGCTAGAGTGCCCCATCCCTGATGCCCCCGTTGTCACCA
ACGTGACTGTGAAGGCACGAGTGTGGAACAGCACCTTCATCGAGGATTACAGAGACTTTG
ACCGAGTCCGGGTAAATGGCTGGGCTACCCTATTCCTCCGAACCAGCATCCCCACCATCA
ACATGGAGAACAAGACCACGTGGTTCTCTGTGGACATTGACTCGGAGCTGGTGGAGGAGC
TGCCGGCCGAAATCGAGCTGTGGCTGGTGCTGGTGGCCGTGGGTGCAGGGCTGCTGCTGC
TGGGGCTGATCATCCTCCTGCTGTGGAAGTGCGGCTTCTTCAAGCGAGCCCGCACTCGCG
CCCTGTATGAAGCTAAGAGGCAGAAGGCGGAGATGAAGAGCCAGCCGTCAGAGACAGAGA
GGCTGACCGACGACTACTGAGGGGGCAGCCCCCCGCCCCCGGCCCACCTGGTGTGACTTC
TTTAAGCGGACCCGCTATTATCAGATCATGCCCAAGTACCACGCAGTGCGGATCCGGGAG
GAGGAGCGCTACCCACCTCCAGGGAGCACCCTGCCCACCAAGAAGCACTGGGTGACCAGC
TGGCAGACTCGGGACCAATACTACTGACGTCCTCCCTGATCCCACCCCCTCCTCCCCCAG
TGTCCCCTTTCTTCCTATTTATCATAAGTTATGCCTCTGACAGTCCACAGGGGCCACCAC
CTTTGGCTGGTAGCAGCAGGCTCAGGCACATACACCTCGTCAAGAGCATGCACATGCTGT
CTGGCCCTGGGGATCTTCCCACAGGAGGGCCAGCGCTGTGGACCTTACAACGCCGAGTGC
ACTGCATTCCTGTGCCCTAGATGCACGTGGGGCCCACTGCTCGTGGACTGTGCTGGTGCA
TCACGGATGGTGCATGGGCTCGCCGTGTCTCAGCCTCTGCCAGCGCCAAAACAAGCCAAA
GAGCCTCCCACCAGAGCCGGGAGGAAAAGGCCCCTGCAATGTGGTGACACCTCCCCCTTT
CACACTGGATCCATCTTGAGCCACAGTCACTGGATTGACTTTGCTGTCAAAACTACTGAC
AGGGAGCAGCCCCCGGGCCGCTGGCTGGTGGGCCCCCAATGACACCCATGCCAGAGAGGT
GGGGATCCTGCCTAAGGTTGTCTACGGGGGCACTTGGAGGACCTGGCGTGCTCAGACCCA
ACAGCAAAGGAACTAGAAAGAAGGACCCAGAACGGCTTGCTTTCCTGCATCTCTGTGAAG
CCTCTCTCCTTGGCCACAGACTGAACTCGCAGGGAATGCAGCAGGAAGGAACAAAGACAG
GCAAACGGCAACGTAGCCTGGGCTCACTGTGCTGGGGCACGGCGGGATCCTCCACAGAGA
GGAGGGGACCAATTCTGGACAGACAGATGTTGGGAGGATACAGAGGAGATGCCACTTCTC
ACTCACCACTACCAGCCAGCCTCAGAAGGCCCCAGAGAGACCCTGCAAGACCACGGAGGG
AGCGACACTTGAATGTAGAATAGGCAGGGGGCCCTGCCCCACCCCATCCAGCCAGACCCC
ACGCTGACCATGCGTCAGGGGCCTAGAGGTGGAGTTCTTAGCTATCCTTGGCTTTCAGAG
CCAGCCTGGCTCTGCCCCCTCCCCCATGGGCTGTGTCCTAAGGCCCATTTGAGAAGCTGA
GGCTAGTTCCAGAAAACCTCTCCTGACCCCTGCCTGTTGGCAGGCCCACTCCCCAGCCCC
AGCCCCTTCCATGGTACTGTAGCAGGGGAATTCCCTCCCCCTCCTTGTGCCTTCTTTGTA
TATAGGCTTCTCACGGCGACCAATAAACAGCTCCCAGTTTGTATGCAAAAAAAAAAAAAA
AAAA

Protein Sequence

>3675 : length: 1066
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYK
DPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNT
RTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF
EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRT
SIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCDFFK
RTRYYQIMPKYHAVRIREEERYPPPGSTLPTKKHWVTSWQTRDQYY