ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3662

Name

IRF4

Synonym

LSIRF|MUM1|NF-EM5|SHEP8;interferon regulatory factor 4;IRF4;interferon regulatory factor 4

Definition

lymphocyte-specific interferon regulatory factor|multiple myeloma oncogene 1

Position

6p25-p23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

IL4-mediated signaling events;PID Curated;200018

Disease

Eye color;NHGRI

Disease

IMMUNE;GAD

Disease

Bone marrow disease;FunDO

Disease

Celiac disease;NHGRI

Disease

Hair color;NHGRI

Disease

Freckling;NHGRI

Disease

HIV;GAD

Disease

Multiple myeloma;OMIM

Disease

Celiac Disease;GAD

Disease

Melanoma;FunDO

Disease

Chronic lymphocytic leukemia;GAD

Disease

Black vs blond hair color;GAD

Disease

Black vs. red hair color;NHGRI

Disease

Leukemia;FunDO

Disease

CANCER;GAD

Disease

freckles;GAD

Disease

INFECTION;GAD

Disease

DEVELOPMENTAL;GAD

Disease

Black vs red hair color;GAD

Disease

Black vs. blond hair color;NHGRI

Disease

Chronic lymphocytic leukemia;NHGRI

External Links

Links to cell senescence gene database

3662

Links to epithelial mesenchymal transition gene database

3662

Links to ovarian cancer gene database

3662

Links to endometrial cancer gene database

3662

Links to iHOP

3662

Sequence Information

Nucleotide Sequence

>3662 : length: 5463
ACCTCGCACTCTCAGTTTCACCGCTCGATCTTGGGACCCACCGCTGCCCTCAGCTCCGAG
TCCAGGGCGAGTGCAGAGCAGAGCGGGCGGAGGACCCCGGGCGCGGGCGCGGACGGCACG
CGGGGCATGAACCTGGAGGGCGGCGGCCGAGGCGGAGAGTTCGGCATGAGCGCGGTGAGC
TGCGGCAACGGGAAGCTCCGCCAGTGGCTGATCGACCAGATCGACAGCGGCAAGTACCCC
GGGCTGGTGTGGGAGAACGAGGAGAAGAGCATCTTCCGCATCCCCTGGAAGCACGCGGGC
AAGCAGGACTACAACCGCGAGGAGGACGCCGCGCTCTTCAAGGCTTGGGCACTGTTTAAA
GGAAAGTTCCGAGAAGGCATCGACAAGCCGGACCCTCCCACCTGGAAGACGCGCCTGCGG
TGCGCTTTGAACAAGAGCAATGACTTTGAGGAACTGGTTGAGCGGAGCCAGCTGGACATC
TCAGACCCGTACAAAGTGTACAGGATTGTTCCTGAGGGAGCCAAAAAAGGAGCCAAGCAG
CTCACCCTGGAGGACCCGCAGATGTCCATGAGCCACCCCTACACCATGACAACGCCTTAC
CCTTCGCTCCCAGCCCAGGTTCACAACTACATGATGCCACCCCTCGACCGAAGCTGGAGG
GACTACGTCCCGGATCAGCCACACCCGGAAATCCCGTACCAATGTCCCATGACGTTTGGA
CCCCGCGGCCACCACTGGCAAGGCCCAGCTTGTGAAAATGGTTGCCAGGTGACAGGAACC
TTTTATGCTTGTGCCCCACCTGAGTCCCAGGCTCCCGGAGTCCCCACAGAGCCAAGCATA
AGGTCTGCCGAAGCCTTGGCGTTCTCAGACTGCCGGCTGCACATCTGCCTGTACTACCGG
GAAATCCTCGTGAAGGAGCTGACCACGTCCAGCCCCGAGGGCTGCCGGATCTCCCATGGA
CATACGTATGACGCCAGCAACCTGGACCAGGTCCTGTTCCCCTACCCAGAGGACAATGGC
CAGAGGAAAAACATTGAGAAGCTGCTGAGCCACCTGGAGAGGGGCGTGGTCCTCTGGATG
GCCCCCGACGGGCTCTATGCGAAAAGACTGTGCCAGAGCAGGATCTACTGGGACGGGCCC
CTGGCGCTGTGCAACGACCGGCCCAACAAACTGGAGAGAGACCAGACCTGCAAGCTCTTT
GACACACAGCAGTTCTTGTCAGAGCTGCAAGCGTTTGCTCACCACGGCCGCTCCCTGCCA
AGATTCCAGGTGACTCTATGCTTTGGAGAGGAGTTTCCAGACCCTCAGAGGCAAAGAAAG
CTCATCACAGCTCACGTACTTAGGAGTTTAGCTTAAGTCGTCATATATAAAATACAGTCT
CTAATATCATGATTGATGGAGAGCATTCAGCTTGCCTTAGATGCTGTAAATTCAGGAAAA
GCTGAACATTAAGGCGTTTTTGTTTTTTGGTAGAACCTCTGCTAGCCAGACAACTATATT
ATTTTGCTCAACAAAACAGTGGACATTTCCTGAGGGGCTACGATTTACCAGAACACATCA
GCAATCCAGAAGATTACCACAGATCTATCCGCCATTCCTCTATTCAAGAATGAAAAATGT
CAAGATGAGTGGTTTTCTTTTTCCTTTTTTTTTTTTTTTTTTTGATACGGGGATACGGGG
TCTTGCTCTGTCTCCCAGGCTGGAGTGCAGTGACACAATCTCAGCTCACTGTGACCTCCG
CCTCCTGGGTTCAAGAGACTCTCCTGCCTCAGCCTCCCTGGTAGCTGGGATTACAGGTGT
GAGCCACTGCACCCACCCAAGACAAGTGATTTTCATTGTAAATATTTGACTTTAGTGAAA
GCGTCCAATTGACTGCCCTCTTACTGTTTTGAGGAATTCAGAAGTGGAGATTTCAGTTCA
GCGGTTGAGGAGAATTGCGGCGAGACAAGCATGGAAAATCAGTGACATCTGATTGGCAGA
TGAGCTTATTTCAAAAGGAAGGGTGGCTTTGCATTTCTTGTGTTCTGTAGACTGCCATCA
TTGATGATCACTGTGAAAATTGACCAAGTGATGTGTTTACATTTACTGAAATGCGCTCTT
TAATTTGTTGTAGATTAGGTCTTGCTGGAAGACAGAGAAAACTTGCCTTTCAGTATTGAC
ACTGACTAGAGTGATGACTGCTTGTAGGTATGTCTGTGCCATTTCTCAGGGAAGTAAGAT
GTAAATTGAAGAAGCCTCACACGTAAAAGAAATGTATTAATGTATGTAGGAGCTGCAGTT
CTTGTGGAAGACACTTGCTGAGTGAAGGAAATGAATCTTTGACTGAAGCCGTGCCTGTAG
CCTTGGGGAGGCCCATCCCCCACCTGCCAGCGGTTTCCTGGTGTGGGTCCCTCTGCCCCG
CCCTCCTTCCCATTGGCTTTCTCTCCTTGGCCTTTCCTGGAAGCCAGTTAGTAAACTTCC
TATTTTCTTGAGTCAAAAAACATGAGCGCTACTCTTGGATGGGACATTTTTGTCTGTCCT
ACAATCTAGTAATGTCTAAGTAATGGTTAAGTTTTCTTGTTTCTGCATCTTTTTGACCCT
CATTCTTTAGAGATGCTAAAATTCTTCGCATAAAGAAGAAGAAATTAAGGAACATAAATC
TTAATACTTGAACTGTTGCCCTTCTGTCCAAGTACTTAACTATCTGTTCCCTTCCTCTGT
GCCACGCTCCTCTGTTTGTTTGGCTGTCCAGCGATCAGCCATGGCGACACTAAAGGAGGA
GGAGCCGGGGACTCCCAGGCTGGAGAGCACTGCCAGGACCCACCACTGGAAGCAGGATGG
AGCTGACTACGGAACTGCACACTCAGTGGGCTGTTTCTGCTTATTTCATCTGTTCTATGC
TTCCTCGTGCCAATTATAGTTTGACAGGGCCTTAAAATTACTTGGCTTTTTCCAAATGCT
TCTATTTATAGAATCCCAAAGACCTCCACTTGCTTAAGTATACCTATCACTTACATTTTT
GTGGTTTTGAGAAAGTACAGCAGTAGACTGGGGCGTCACCTCCAGGCCGTTTCTCATACT
ACAGGATATTTACTATTACTCCCAGGATCAGCAGAAGATTGCGTAGCTCTCAAATGTGTG
TTCCTGCTTTTCTAATGGATATTTTAAATTCATTCAACAAGCACCTAGTAAGTGCCTGCT
GTATCCCTACATTACACAGTTCAGCCTTTATCAAGCTTAGTGAGCAGTGAGCACTGAAAC
ATTATTTTTTAATGTTTAAAAAGTTTCTAATATTAAAGTCAGAATATTAATACAATTAAT
ATTAATATTAACTACAGAAAAGACAAACAGTAGAGAACAGCAAAAAAATAAAAAGGATCT
CCTTTTTTCCCAGCCCAAATTCTCCTCTCTAAAAGTGTCCACAAGAAGGGGTGTTTATTC
TTCCAACACATTTCACTTTTCTGTAAATATACATAAACTTAAAAAGAAAACCTCATGGAG
TCATCTTGCACACACTTTCATGCAGTGCTCTTTGTAGCTAACAGTGAAGATTTACCTCGT
TCTGCTCAGAGGCCTTGCTGTGGAGCTCCACTGCCATGTACCCAGTAGGGTTTGACATTT
CATTAGCCATGCAACATGGATATGTATTGGGCAGCAGACTGTGTTTCGTGAACTGCAGTG
ATGTATACATCTTATAGATGCAAAGTATTTTGGGGTATATTATCCTAAGGGAAGATAAAG
ATGATATTAAGAACTGCTGTTTCACGGGGCCCTTACCTGTGACCCTCTTTGCTGAAGAAT
ATTTAACCCCACACAGCACTTCAAAGAAGCTGTCTTGGAAGTCTGTCTCAGGAGCACCCT
GTCTTCTTAATTCTCCAAGCGGATGCTCCATTTCAATTGCTTTGTGACTTCTTCTTCTTT
GTTTTTTTAAATATTATGCTGCTTTAACAGTGGAGCTGAATTTTCTGGAAAATGCTTCTT
GGCTGGGGCCACTACCTCCTTTCCTATCTTTACATCTATGTGTATGTTGACTTTTTAAAA
TTCTGAGTGATCCAGGGTATGACCTAGGGAATGAACTAGCTATGAAATACTCAGGGTTAG
GAATCCTAGCACTTGTCTCAGGACTCTGAAAAGGAACGGCTTCCTCATTCCTTGTCTTGA
TAAAGTGGAATTGGCAAACTAGAATTTAGTTTGTACTCAGTGGACAGTGCTGTTGAAGAT
TTGAGGACTTGTTAAAGAGCACTGGGTCATATGGAAAAAATGTATGTGTCTCCCAGGTGC
ATTTCTTGGTTTATGTCTTGTTCTTGAGATTTTGTATATTTAGGAAAACCTCAAGCAGTA
ATTAATATCTCCTGGAACACTATAGAGAACCAAGTGACCGACTCATTTACAACTGAAACC
TAGGAAGCCCCTGAGTCCTGAGCGAAAACAGGAGAGTTAGTCGCCCTACAGAAAACCCAG
CTAGACTATTGGGTATGAACTAAAAAGAGACTGTGCCATGGTGAGAAAAATGTAAAATCC
TACAGTGAAATGAGCAGCCCTTACAGTATTGTTACCACCAAGGGCAGGTAGGTATTAGTG
TTTGAAAAAGCTGGTCTTTGAGCGAGGGCATAAATACAGCTAGCCCCAGGGGTGGAACAA
CTCTGGGAGTCTTGGGTACTCGCACCTCTTGGCTTTGTTGATGCTCCGCCAGGAAGGCCA
CTTGTGTGTGCGTGTCAGTTACTTTTTTAGTAACAATTCAGATCCAGTGTAAACTTCCGT
TCATTGCTCTCCAGTCACATGCCCCCACTTCCCCACAGGTGAAAGTTTTTCTGAAAGTGT
TGGGATTGGTTAAGGTCTTTATTTGTATTACGTATCTCCCCAAGTCCTCTGTGGCCAGCT
GCATCTGTCTGAATGGTGCGTGAAGGCTCTCAGACCTTACACACCATTTTGTAAGTTATG
TTTTACATGCCCCGTTTTTGAGACTGATCTCGATGCAGGTGGATCTCCTTGAGATCCTGA
TAGCCTGTTACAGGAATGAAGTAAAGGTCAGTTTTTTTTTGTATTGATTTTCACAGCTTT
GAGGAACATGCATAAGAAATGTAGCTGAAGTAGAGGGGACGTGAGAGAAGGGCCAGGCCG
GCAGGCCAACCCTCCTCCAATGGAAATTCCCGTGTTGCTTCAAACTGAGACAGATGGGAC
TTAACAGGCAATGGGGTCCACTTCCCCCTCTTCAGCATCCCCCGTACCCCACTTTCTGCT
GAAAGAACTGCCAGCAGGTAGGACCCCAGAGGCCCCCAAATGAAAGCTTGAATTTCCCCT
ACTGGCTCTGCGTTTTGCTGAGATCTGTAGGAAAGGATGCTTCACAAACTGAGGTAGATA
ATGCTATGCTGTCGTTGGTATACATCATGAATTTTTATGTAAATTGCTCTGCAAAGCAAA
TTGATATGTTTGATAAATTTATGTTTTTAGGTAAATAAAAACTTTTAAAAATTTGTTAAA
AAA

Protein Sequence

>3662 : length: 451
MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQ
DYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD
PYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRD
YVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIR
SAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQ
RKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFD
TQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN
SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE