ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3660

Name

IRF2

Synonym

IRF-2;interferon regulatory factor 2;IRF2;interferon regulatory factor 2

Definition

-

Position

4q34.1-q35.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3660

Links to epithelial mesenchymal transition gene database

3660

Links to ovarian cancer gene database

3660

Links to endometrial cancer gene database

3660

Links to iHOP

3660

Sequence Information

Nucleotide Sequence

>3660 : length: 2302
AGCCGCGGCTCTTCGCAGTTTCCTCTCCTTGTTTTGCTTTCGATCTGGACTGTTCTCAGG
CAAGCCGGGGAGTAACTTTTAGTTTTGCTCCTGCGATTATTCAACTGACGGGCTTTCATT
TCCATTTCACATACCCTAGCAACACTTATACCTTGCGGAATTGTATTGGTAGCGTGAAAA
AAGCACACTGAGAGGGCACCATGCCGGTGGAAAGGATGCGCATGCGCCCGTGGCTGGAGG
AGCAGATAAACTCCAACACGATCCCGGGGCTCAAGTGGCTTAACAAGGAAAAGAAGATTT
TTCAGATCCCCTGGATGCATGCGGCTAGACATGGGTGGGATGTGGAAAAAGATGCACCAC
TCTTTAGAAACTGGGCAATCCATACAGGAAAGCATCAACCAGGAGTAGATAAACCTGATC
CCAAAACATGGAAGGCGAATTTCAGATGCGCCATGAATTCCTTGCCTGATATTGAAGAAG
TCAAGGATAAAAGCATAAAGAAAGGAAATAATGCCTTCAGGGTCTACCGAATGCTGCCCC
TATCAGAACGGCCTTCTAAGAAAGGAAAGAAACCAAAGACAGAAAAAGAAGACAAAGTTA
AGCACATCAAGCAAGAACCAGTTGAGTCATCTCTGGGGCTTAGTAATGGAGTAAGTGATC
TTTCTCCTGAGTATGCGGTCCTGACTTCAACTATAAAAAATGAAGTGGATAGTACGGTGA
ACATCATAGTTGTAGGACAGTCCCATCTGGACAGCAACATTGAGAATCAAGAGATTGTCA
CCAATCCGCCAGACATTTGCCAAGTTGTAGAGGTGACCACTGAGAGCGACGAGCAGCCGG
TCAGCATGAGCGAGCTCTACCCTCTGCAGATCTCCCCCGTGTCTTCCTATGCAGAAAGCG
AAACGACTGATAGTGTGCCCAGCGATGAAGAGAGTGCCGAGGGGCGGCCACACTGGCGGA
AGAGGAATATTGAAGGCAAACAGTACCTCAGCAACATGGGGACTCGAGGCTCCTACCTGC
TGCCCGGCATGGCGTCCTTCGTCACTTCCAACAAACCGGACCTCCAGGTCACCATCAAAG
AGGAGAGCAATCCGGTGCCTTACAACAGCTCCTGGCCCCCTTTTCAAGACCTCCCCCTTT
CTTCCTCCATGACCCCAGCATCCAGCAGCAGTCGGCCAGACCGGGAGACCCGGGCCAGCG
TCATCAAGAAAACATCGGATATCACCCAGGCCCGCGTCAAGAGCTGTTAAGCCTCTGACT
CTCCGCGGTGGTTGTTGGGGCTTCTTGGCTTTGTTTTGTTGTTTGTTTGTATTTTATTTT
TTTCTCTCTGACACCTATTTTAGACAAATCTAAGGGAAAAAGCCTTGACAATAGAACATT
GATTGCTGTGTCCAACTCCAGTACTGGAGCTTCTCTTTAACTCAGGACTCCAGCCCATTG
GTAGACGTGTGTTTCTAGAGCCTGCTGGATCTCCCAGGGCTACTCACTCAAGTTCAAGGA
CCAACAAGGGCAGTGGAGGTGCTGCATTGCCTGCGGTCAAGGCCAGCAAGGTGGAGTGGA
TGCCTCAGAACGGACGAGATAATGTGAACTAGCTGGAATTTTTTATTCTTGTGAATATGT
ACATAGGCAGCACTAGCGACATTGCAGTCTGCTTCTGCACCTTATCTTAAAGCACTTACA
GATAGGCCTTCTTGTGATCTTGCTCTATCTCACAGCACACTCAGCACCCCCTTCTCTGCC
CATTCCCCAGCCTCTCTTCCTATCCCATCCCATCCCATCCCATCCCATCCCATCCCATCC
CGCTCTTTTCCTACTTTTCCTTCCCTCAAAGCTTCCATTCCACATCCGGAGGAGAAGAAG
GAAATGAATTTCTCTACAGATGTCCCATTTTCAGACTGCTTTAAAAAAAATCCTTCTAAT
CTGCTATGCTTGAATGCCACGCGGTACAAAGGAAAAAGTATCATGGAAATATTATGCAAA
TTCCCAGATTTGAAGACAAAAATACTCTAATTCTAACCAGAGCAAGCTTTTTTATTTTTT
ATACAGGGGAATATTTTATTCAAGGTAAAATTCTAAATAAAATATAATTGTTTTTTATCT
TTTCTACAGCAAATTTATAATTTTAAGATTCCTTTTCTTGTTTATCAGCAGTTGTTATTA
CATCCTTGTGGCACATTTTTTTTTTTAATTTTGTAAAGGTGAAAAAAGCTTTTATGAGCT
CATGTAGCAATCAGATTTTCCTGTGGATTGATAATAAATGAATATGATATATAGTTAAAT
TTTTAAAAAAAAAAAAAAAAAA

Protein Sequence

>3660 : length: 349
MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI
HTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSK
KGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQ
SHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVP
SDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVP
YNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC