ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3646

Name

EIF3E

Synonym

EIF3-P48|EIF3S6|INT6|eIF3-p46;eukaryotic translation initiation factor 3, subunit E;EIF3E;eukaryotic translation initiation factor 3, subunit E

Definition

eIF-3 p48|eukaryotic translation initiation factor 3 subunit 6|eukaryotic translation initiation factor 3 subunit E|eukaryotic translation initiation factor 3, subunit 6 (48kD)|eukaryotic translation initiation factor 3, subunit 6 48kDa|mammary tumor-asso

Position

8q22-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

Pathway

3' -UTR-mediated translational regulation;Reactome;REACT:1762

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Metabolism of proteins;Reactome;REACT:17015

Disease

Lung cancer;FunDO

External Links

Links to cell senescence gene database

3646

Links to epithelial mesenchymal transition gene database

3646

Links to ovarian cancer gene database

3646

Links to endometrial cancer gene database

3646

Links to iHOP

3646

Sequence Information

Nucleotide Sequence

>3646 : length: 1516
GAGCACAGACTCCCTTTTCTTTGGCAAGATGGCGGAGTACGACTTGACTACTCGCATCGC
GCACTTTTTGGATCGGCATCTAGTCTTTCCGCTTCTTGAATTTCTCTCTGTAAAGGAGAT
ATATAATGAAAAGGAATTATTACAAGGTAAATTGGACCTTCTTAGTGATACCAACATGGT
AGACTTTGCTATGGATGTATACAAAAACCTTTATTCTGATGATATTCCTCATGCTTTGAG
AGAGAAAAGAACCACAGTGGTTGCACAACTGAAACAGCTTCAGGCAGAAACAGAACCAAT
TGTGAAGATGTTTGAAGATCCAGAAACTACAAGGCAAATGCAGTCAACCAGGGATGGTAG
GATGCTCTTTGACTACCTGGCGGACAAGCATGGTTTTAGGCAGGAATATTTAGATACACT
CTACAGATATGCAAAATTCCAGTACGAATGTGGGAATTACTCAGGAGCAGCAGAATATCT
TTATTTTTTTAGAGTGCTGGTTCCAGCAACAGATAGAAATGCTTTAAGTTCACTCTGGGG
AAAGCTGGCCTCTGAAATCTTAATGCAGAATTGGGATGCAGCCATGGAAGACCTTACACG
GTTAAAAGAGACCATAGATAATAATTCTGTGAGTTCTCCACTTCAGTCTCTTCAGCAGAG
AACATGGCTCATTCACTGGTCTCTGTTTGTTTTCTTCAATCACCCCAAAGGTCGCGATAA
TATTATTGACCTCTTCCTTTATCAGCCACAATATCTTAATGCAATTCAGACAATGTGTCC
ACACATTCTTCGCTATTTGACTACAGCAGTCATAACAAACAAGGATGTTCGAAAACGTCG
GCAGGTTCTAAAAGATCTAGTTAAAGTTATTCAACAGGAGTCTTACACATATAAAGACCC
AATTACAGAATTTGTTGAATGTTTATATGTTAACTTTGACTTTGATGGGGCTCAGAAAAA
GCTGAGGGAATGTGAATCAGTGCTTGTGAATGACTTCTTCTTGGTGGCTTGTCTTGAGGA
TTTCATTGAAAATGCCCGTCTCTTCATATTTGAGACTTTCTGTCGCATCCACCAGTGTAT
CAGCATTAACATGTTGGCAGATAAATTGAACATGACTCCAGAAGAAGCTGAAAGGTGGAT
TGTAAATTTGATTAGAAATGCAAGACTGGATGCCAAGATTGATTCTAAATTAGGTCATGT
GGTTATGGGTAACAATGCAGTCTCACCCTATCAGCAAGTGATTGAAAAGACCAAAAGCCT
TTCCTTTAGAAGCCAGATGTTGGCCATGAATATTGAGAAGAAACTTAATCAGAATAGCAG
GTCAGAGGCTCCTAACTGGGCAACTCAAGATTCTGGCTTCTACTGAAGAACCATAAAGAA
AAGATGAAAAAAAAAACTATCAAAGAAAGATGAAATAATAAAACTATTATATAAAGGGTG
ACTTACATTTTGGAAACAACATATTACGTATAAATTTTGAAGAATTGGAATAAAATTGAT
TCATTTTAAAAAAAAA

Protein Sequence

>3646 : length: 445
MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKN
LYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK
HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ
NWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQP
QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY
VNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKL
NMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM
NIEKKLNQNSRSEAPNWATQDSGFY