ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3636

Name

INPPL1

Synonym

OPSMD|SHIP2;inositol polyphosphate phosphatase-like 1;INPPL1;inositol polyphosphate phosphatase-like 1

Definition

51C protein|INPPL-1|SH2 domain-containing inositol 5'-phosphatase 2|SH2 domain-containing inositol-5'-phosphatase 2|SHIP-2|phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2|phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2|protein 51C

Position

11q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

superpathway of D-myo-inositol (1,4,5)-trisphosphate metabolism;BioCyc;PWY-6358

Pathway

Phosphatidylinositol signaling system;KEGG PATHWAY;hsa04070

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

1D-myo-inositol hexakisphosphate biosynthesis II (mammalian);BioCyc;PWY-6362

Pathway

Inositol phosphate metabolism;KEGG PATHWAY;hsa00562

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

3-phosphoinositide degradation;BioCyc;PWY-6368

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

D-myo-inositol (1,4,5)-trisphosphate degradation;BioCyc;PWY-6363

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

D-myo-inositol (1,3,4)-trisphosphate biosynthesis;BioCyc;PWY-6364

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

EPHA2 forward signaling;PID Curated;200185

Disease

Embryoma;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Carcinoma;FunDO

Disease

Hypertension;FunDO

Disease

Glucose intolerance;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

3636

Links to epithelial mesenchymal transition gene database

3636

Links to ovarian cancer gene database

3636

Links to endometrial cancer gene database

3636

Links to iHOP

3636

Sequence Information

Nucleotide Sequence

>3636 : length: 5063
GGGAAGGGGGCGCCGGAGCAGCCCGGGAGGTGGGGGTCTGCGTGCGGCGGCCGGGATCCC
GGGAGGGAACTTTCTACTAGACGGGCCAGGGATCCTCCTGGCTTCGGACTGCTGAACCCC
CTCAAGGCCCGGCCTGCGGGTGTGGGGGGTGGTGCTGGGGAACTTGGCCGAGAGGGGGAA
GGGCTCTGCGGGGCTGGGAGGGGCTGCGTGAGAGGCTCGAGAACGTCGCACCTCGTCTGG
GCCCCCCGCCAGATTGAGGCCGGCGCTGCAGGCAGCGGCGGCTGCGCGGTGAACGAGGCG
GCCTGCGCGGCGGAGTGCTGAGTCCCGATCCCCGGCTCTGTCCGGCCCACGGATCCTCAA
GCCCGGGCCCCGGGCCCGGCCCCAGCCTCAGCCCTGAGCGTCTCGGGGCGGATGGCGCGG
GGCGGCGGGGGCGGGCGGTGCTGAGCCCTGCGCGGGCCATGGCCTCGGCCTGCGGGGCGC
CGGGCCCGGGGGGCGCCCTGGGCAGCCAGGCCCCCTCCTGGTACCACCGCGACCTGAGCC
GGGCGGCCGCGGAGGAGCTGCTGGCCCGGGCGGGCCGCGATGGCAGCTTCCTGGTCCGAG
ACAGCGAGAGCGTGGCGGGGGCCTTCGCGCTCTGCGTCCTGTATCAGAAGCATGTGCACA
CGTATCGCATTCTGCCTGATGGAGAAGATTTCTTGGCTGTGCAGACCTCGCAGGGTGTGC
CTGTGCGCCGCTTCCAGACCCTGGGTGAGCTCATCGGCCTGTACGCCCAGCCCAACCAGG
GCCTTGTGTGCGCCCTGCTTCTTCCTGTAGAGGGTGAGCGAGAGCCGGACCCACCGGATG
ACCGGGATGCCTCAGATGGGGAGGATGAGAAGCCCCCGCTGCCCCCGCGCTCTGGCTCCA
CCAGCATTTCTGCCCCCACTGGGCCCAGCAGTCCCCTGCCAGCTCCTGAGACTCCCACAG
CTCCAGCTGCTGAGAGGGATGGGGCAGAGGTGCTGGGACAGGTCAGCAGGACCTCCACTG
ACTTCTTAACCCCTCCCCAAAGTGCTCCCAATGGGCTGAGCACCGTCTCGCACGACTACC
TGAAAGGCAGCTATGGGCTGGACCTGGAAGCTGTGAGGGGTGGAGCCAGCCACCTGCCCC
ACCTCACCCGTACCCTCGCTACCTCATGCCGGAGGCTGCACAGTGAGGTGGACAAGGTCC
TGTCAGGCCTGGAGATCCTGTCCAAGGTGTTTGACCAGCAGAGCTCGCCCATGGTGACCC
GCCTTTTGCAGCAGCAGAACCTGCCACAGACAGGGGAGCAGGAACTAGAGAGCCTGGTGC
TGAAGCTGTCAGTGCTAAAGGACTTCCTGTCAGGCATCCAGAAGAAGGCCCTGAAGGCCC
TACAGGACATGAGCTCCACAGCACCCCCAGCTCCGCAGCCATCCACACGTAAGGCCAAGA
CCATCCCCGTGCAGGCCTTTGAGGTGAAGCTAGATGTGACCCTGGGTGACCTGACCAAGA
TTGGGAAGTCACAGAAGTTCACGCTGAGCGTGGATGTGGAGGGTGGGCGGCTGGTGCTGC
TGCGGAGACAGCGGGACTCCCAGGAGGACTGGACCACCTTCACGCACGACCGCATCCGCC
AGCTCATTAAGTCCCAGCGTGTCCAGAACAAGCTGGGTGTTGTGTTTGAGAAGGAGAAGG
ACCGGACTCAGCGCAAGGACTTCATCTTTGTCAGTGCCCGGAAGCGGGAGGCCTTCTGCC
AGCTGTTGCAGCTCATGAAGAACAAGCACTCCAAGCAGGACGAGCCCGACATGATCTCAG
TCTTCATAGGCACCTGGAACATGGGAAGTGTACCACCTCCAAAAAACGTGACATCCTGGT
TCACATCGAAGGGTCTGGGGAAGACCCTGGACGAGGTCACAGTGACCATACCCCATGACA
TCTATGTCTTTGGGACCCAGGAGAACTCAGTGGGCGACCGCGAGTGGCTGGACCTACTGC
GCGGGGGCCTCAAGGAGCTTACGGATCTGGATTACCGCCCGATTGCCATGCAATCACTGT
GGAATATCAAGGTGGCAGTGCTGGTCAAGCCAGAGCACGAGAACCGTATCAGCCATGTCA
GTACGTCCAGTGTGAAGACTGGCATCGCCAACACCCTGGGGAACAAGGGGGCTGTGGGCG
TCTCCTTCATGTTTAATGGCACCTCATTTGGCTTTGTGAATTGTCACCTCACCTCGGGAA
ATGAGAAGACGGCTCGGAGGAACCAAAACTACTTGGACATCCTGCGGCTGCTCTCGCTGG
GCGACCGGCAGCTCAATGCCTTTGACATCTCTCTGCGTTTCACACACCTCTTCTGGTTTG
GGGACCTCAACTACCGCCTGGACATGGATATCCAGGAGATCCTGAACTACATCAGCAGGA
AAGAGTTTGAGCCCCTCCTCAGGGTGGACCAGCTCAACCTGGAGCGGGAGAAGCACAAGG
TCTTCCTTCGATTCAGTGAGGAGGAGATCTCCTTCCCACCCACCTACCGCTATGAGCGGG
GTTCCCGGGACACATATGCCTGGCACAAGCAGAAGCCAACTGGGGTCCGGACCAATGTGC
CCTCATGGTGTGACCGGATTCTGTGGAAATCCTACCCTGAAACTCACATCATCTGCAATT
CTTATGGTTGCACTGATGACATCGTCACCAGCGACCATTCCCCCGTGTTTGGGACATTTG
AGGTTGGAGTTACCTCCCAGTTCATCTCCAAGAAAGGGCTCTCAAAGACTTCAGACCAGG
CCTACATTGAGTTTGAGAGCATCGAGGCCATTGTGAAGACAGCCAGCCGCACCAAGTTCT
TCATCGAGTTCTACTCTACCTGCCTGGAGGAATACAAGAAGAGCTTTGAGAATGATGCCC
AGAGCAGTGACAACATCAACTTCCTCAAAGTGCAGTGGTCTTCACGCCAGCTGCCCACGC
TCAAACCAATTCTGGCTGATATCGAGTACCTGCAGGACCAGCACCTCCTGCTCACAGTCA
AGTCCATGGATGGCTATGAATCCTATGGGGAGTGTGTGGTTGCACTCAAATCCATGATCG
GCAGCACGGCCCAACAGTTCCTGACCTTCCTATCCCACCGTGGCGAGGAGACAGGCAATA
TCAGAGGCTCCATGAAGGTGCGGGTGCCCACGGAGCGCCTGGGCACCCGTGAGCGGCTCT
ACGAGTGGATCAGCATTGATAAGGATGAGGCAGGAGCAAAGAGCAAAGCCCCCTCTGTGT
CCCGAGGGAGCCAGGAGCCCAGGTCAGGGAGCCGCAAGCCAGCCTTCACAGAGGCCTCCT
GCCCGCTCTCCAGGTTATTTGAAGAACCAGAGAAACCGCCACCAACGGGGAGGCCCCCAG
CCCCACCCCGAGCAGCTCCCCGGGAGGAGCCCTTGACCCCCAGGTTGAAGCCAGAGGGAG
CTCCTGAACCAGAAGGGGTGGCGGCCCCCCCACCCAAGAACAGCTTCAATAACCCTGCCT
ACTACGTCCTTGAAGGGGTCCCGCACCAGCTGCTGCCCCCGGAGCCACCCTCGCCTGCCA
GGGCCCCTGTCCCATCTGCCACCAAGAACAAAGTGGCCATTACAGTGCCTGCTCCACAGC
TTGGGCACCACCGGCACCCTCGTGTGGGAGAGGGGAGTTCTTCAGATGAGGAGTCTGGAG
GCACACTGCCCCCTCCAGACTTTCCACCTCCACCACTGCCGGACTCAGCCATCTTCCTGC
CCCCCAGCCTGGATCCTTTACCAGGGCCAGTGGTCCGGGGCCGTGGTGGGGCTGAGGCCC
GTGGCCCACCACCTCCCAAGGCCCATCCAAGGCCTCCACTGCCCCCAGGCCCCTCACCAG
CCAGCACTTTCCTGGGGGAAGTGGCCAGTGGGGATGACCGGTCCTGCTCGGTGCTGCAGA
TGGCCAAGACGCTGAGCGAGGTGGACTATGCCCCTGCTGGGCCTGCACGCTCAGCGCTCC
TCCCAGGCCCCCTGGAGCTGCAGCCCCCCCGGGGACTGCCCTCGGACTATGGCCGGCCCC
TCAGCTTCCCTCCACCCCGCATCCGGGAGAGCATCCAGGAAGACCTGGCAGAGGAGGCTC
CGTGCCTGCAGGGCGGGCGGGCCAGCGGGCTGGGCGAGGCAGGCATGAGTGCCTGGCTGC
GGGCCATCGGCTTGGAGCGCTATGAGGAGGGCCTGGTGCATAATGGCTGGGACGACCTGG
AGTTTCTCAGTGACATCACCGAGGAGGACTTGGAGGAGGCTGGGGTGCAGGACCCGGCTC
ACAAGCGCCTCCTTCTGGACACCCTGCAGCTCAGCAAGTGATAGCGGAGGCACCACGAAG
CTGTGAACTCAGAGCCCCTCCCTGCTACCAAGGCCCAGCTATGGCCCCAGGGTTGAAAAG
TTATGAGGGTCAGGGCAGTATCTCTCTGCCTATTTATTGGGGTGCCTATTTATTGGGGAT
CTGCATTCCCCGCTGCCCAATCATTTGCAATGCCCTAATTAGGGCATCCTGCCCCTCGCC
TTTTAGGCTCAGGACGGAAGGTCAGTTGCCATGGTTACCGAGGACCCTGGTTACTCTGGT
GCTGTCCTGTTTTACTGGACCCCGCCTCCCAGCCCCAGGGGTGCCTGTGGGGGTCCATTT
GGGTACGTCTGGGCCCCCACTTTCACCAGTTTCTGCGGCCTTCCACCGGGCCTGAACCAC
AGCGGAGGAGCTCCGCTAAGACCTCCCCACCCCCGCTGGGGGTGGGGGCGGGTGTCCGTC
CGGAAATGAAGGAATAGCCCGAGGACCGGGCTGGGGTTTATTTAAACTGTTCTGTGTGGG
TCTGGGGAGGGAGAGCACCTTAATATTATTGGGGTTGGTTGGGGTGGGGCAGGATCTCAG
CCATAAAGTGCCAGTTTGCTTAGTTCTCACTGTCTCCTGGTCTGTGCTGCCCTGCTCTGG
GGATGCACGGCGGCAGGGTGGGGGAGGGAGGTTCCTCGCAGGTCTCAGCCCGGGACAGGG
TCTTGCAAGCAGCCTCCTGGGCAGTCGTAAGGGTTGCGGCGTGATGTCTTCAATAAATTA
AGTTTTATTTGGATTGAGTAAAA

Protein Sequence

>3636 : length: 1280
MASACGAPGPGGALGSQAPSWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCV
LYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPVEGE
REPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAERDGAEVLG
QVSRTSTDFLTPPQSAPNGLSTVSHDYLKGSYGLDLEAVRGGASHLPHLTRTLATSCRRL
HSEVDKVLSGLEILSKVFDQQSSPMVTRLLQQQNLPQTGEQELESLVLKLSVLKDFLSGI
QKKALKALQDMSSTAPPAPQPSTRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDV
EGGRLVLLRRQRDSQEDWTTFTHDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSA
RKREAFCQLLQLMKNKHSKQDEPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEV
TVTIPHDIYVFGTQENSVGDREWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEH
ENRISHVSTSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLD
ILRLLSLGDRQLNAFDISLRFTHLFWFGDLNYRLDMDIQEILNYISRKEFEPLLRVDQLN
LEREKHKVFLRFSEEEISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYP
ETHIICNSYGCTDDIVTSDHSPVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVK
TASRTKFFIEFYSTCLEEYKKSFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQD
QHLLLTVKSMDGYESYGECVVALKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTER
LGTRERLYEWISIDKDEAGAKSKAPSVSRGSQEPRSGSRKPAFTEASCPLSRLFEEPEKP
PPTGRPPAPPRAAPREEPLTPRLKPEGAPEPEGVAAPPPKNSFNNPAYYVLEGVPHQLLP
PEPPSPARAPVPSATKNKVAITVPAPQLGHHRHPRVGEGSSSDEESGGTLPPPDFPPPPL
PDSAIFLPPSLDPLPGPVVRGRGGAEARGPPPPKAHPRPPLPPGPSPASTFLGEVASGDD
RSCSVLQMAKTLSEVDYAPAGPARSALLPGPLELQPPRGLPSDYGRPLSFPPPRIRESIQ
EDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEE
AGVQDPAHKRLLLDTLQLSK