ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3611

Name

ILK

Synonym

HEL-S-28|ILK-1|ILK-2|P59|p59ILK;integrin-linked kinase;ILK;integrin-linked kinase

Definition

59 kDa serine/threonine-protein kinase|epididymis secretory protein Li 28|integrin-linked kinase-2|integrin-linked protein kinase

Position

11p15.4

Gene Type

protein-coding

Pathways and Diseases

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Cell-extracellular matrix interactions;PID Reactome;500123

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

Localization of the PINCH-ILK-PARVIN complex to focal adhesions;PID Reactome;500124

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

PPAR signaling pathway;KEGG PATHWAY;hsa03320

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

3611

Links to epithelial mesenchymal transition gene database

3611

Links to ovarian cancer gene database

3611

Links to endometrial cancer gene database

3611

Links to iHOP

3611

Sequence Information

Nucleotide Sequence

>3611 : length: 2098
AGCCCGAGTCCCGGTGAGTGCGAGAGGACCCGCGCCCCCTGTCACCCCTCACTTCTCCTG
AGTCCCAAGTAAGGAACGGAGCCAACCCTGGGGAGGACCCCCGGTCCCCTCTCCCAGAGT
ATACGGAGCCTGAACCTCCCCACTTCCCCCAACTCTGTTCGCGGATAGGGTCTAGTTGCC
TGCTCTCGGACATCCGTTCAGCAGACACTACCTCTTCGTCACCCCCTGCCCACCCTGACC
CGCCTTTACCTCGCGTCTAGAGGACACAGCCAGGGATCATCCCGCAGCCCCGAACTCCTT
CACAGACCCCCACTAGCCGGGGACGCAGCTCAGGCCCCCTACCCCCAACACAAACACTTC
TCTCCTGTAGAGGATAAAGCTTGGGGTTCATCCTCCTTCCCTGGATCACTCCACAGTCCT
CAGGCTTCCCCAATCCAGGGGACTCGGCGCCGGGACGCTGCTATGGACGACATTTTCACT
CAGTGCCGGGAGGGCAACGCAGTCGCCGTTCGCCTGTGGCTGGACAACACGGAGAACGAC
CTCAACCAGGGGGACGATCATGGCTTCTCCCCCTTGCACTGGGCCTGCCGAGAGGGCCGC
TCTGCTGTGGTTGAGATGTTGATCATGCGGGGGGCACGGATCAATGTAATGAACCGTGGG
GATGACACCCCCCTGCATCTGGCAGCCAGTCATGGACACCGTGATATTGTACAGAAGCTA
TTGCAGTACAAGGCAGACATCAATGCAGTGAATGAACACGGGAATGTGCCCCTGCACTAT
GCCTGTTTTTGGGGCCAAGATCAAGTGGCAGAGGACCTGGTGGCAAATGGGGCCCTTGTC
AGCATCTGTAACAAGTATGGAGAGATGCCTGTGGACAAAGCCAAGGCACCCCTGAGAGAG
CTTCTCCGAGAGCGGGCAGAGAAGATGGGCCAGAATCTCAACCGTATTCCATACAAGGAC
ACATTCTGGAAGGGGACCACCCGCACTCGGCCCCGAAATGGAACCCTGAACAAACACTCT
GGCATTGACTTCAAACAGCTTAACTTCCTGACGAAGCTCAACGAGAATCACTCTGGAGAG
CTATGGAAGGGCCGCTGGCAGGGCAATGACATTGTCGTGAAGGTGCTGAAGGTTCGAGAC
TGGAGTACAAGGAAGAGCAGGGACTTCAATGAAGAGTGTCCCCGGCTCAGGATTTTCTCG
CATCCAAATGTGCTCCCAGTGCTAGGTGCCTGCCAGTCTCCACCTGCTCCTCATCCTACT
CTCATCACACACTGGATGCCGTATGGATCCCTCTACAATGTACTACATGAAGGCACCAAT
TTCGTCGTGGACCAGAGCCAGGCTGTGAAGTTTGCTTTGGACATGGCAAGGGGCATGGCC
TTCCTACACACACTAGAGCCCCTCATCCCACGACATGCACTCAATAGCCGTAGTGTAATG
ATTGATGAGGACATGACTGCCCGAATTAGCATGGCTGATGTCAAGTTCTCTTTCCAATGT
CCTGGTCGCATGTATGCACCTGCCTGGGTAGCCCCCGAAGCTCTGCAGAAGAAGCCTGAA
GACACAAACAGACGCTCAGCAGACATGTGGAGTTTTGCAGTGCTTCTGTGGGAACTGGTG
ACACGGGAGGTACCCTTTGCTGACCTCTCCAATATGGAGATTGGAATGAAGGTGGCATTG
GAAGGCCTTCGGCCTACCATCCCACCAGGTATTTCCCCTCATGTGTGTAAGCTCATGAAG
ATCTGCATGAATGAAGACCCTGCAAAGCGACCCAAATTTGACATGATTGTGCCTATCCTT
GAGAAGATGCAGGACAAGTAGGACTGGAAGGTCCTTGCCTGAACTCCAGAGGTGTCGGGA
CATGGTTGGGGGAATGCACCTCCCCAAAGCAGCAGGCCTCTGGTTGCCTCCCCCGCCTCC
AGTCATGGTACTACCCCAGCCATGGGGTCCATCCCCTTCCCCCATCCCTACCACTGTGGC
CCCAAGAGGGGCGGGCTCAGAGCTTTGTCACTTGCCACATGGTGTCTCCCAACATGGGAG
GGATCAGCCCCGCCTGTCACAATAAAGTTTATTATGAAAACAGGAAAAAAAAAAAAAA

Protein Sequence

>3611 : length: 452
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK