ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

358

Name

AQP1

Synonym

AQP-CHIP|CHIP28|CO;aquaporin 1 (Colton blood group);AQP1;aquaporin 1 (Colton blood group)

Definition

aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group)|aquaporin-1|aquaporin-CHIP|channel-like integral membrane protein, 28-kDa|urine water channel|water channel protein for red blood cells and kidney proximal tubule

Position

7p14

Gene Type

protein-coding

Pathways and Diseases

Pathway

Proximal tubule bicarbonate reclamation;KEGG PATHWAY;hsa04964

Pathway

Transmembrane transport of small molecules;Reactome;REACT:15518

Disease

Blood group, Colton;OMIM

Disease

Migraine;FunDO

Disease

Subarachnoid hemorrhage;FunDO

Disease

Cancer;FunDO

Disease

Aquaporin-1 deficiency;OMIM

Disease

mild HDN;GAD

Disease

Vascular disease;FunDO

Disease

Intractable epilepsy;FunDO

Disease

Brain disease;FunDO

External Links

Links to cell senescence gene database

358

Links to epithelial mesenchymal transition gene database

358

Links to ovarian cancer gene database

358

Links to endometrial cancer gene database

358

Links to iHOP

358

Sequence Information

Nucleotide Sequence

>358 : length: 2807
GTGCTCCCCCCGCCCCCCGGCCCTATAAATAGGCCCAGCCCAGGCTGTGGCTCAGCTCTC
AGAGGGAATTGAGCACCCGGCAGCGGTCTCAGGCCAAGCCCCCTGCCAGCATGGCCAGCG
AGTTCAAGAAGAAGCTCTTCTGGAGGGCAGTGGTGGCCGAGTTCCTGGCCACGACCCTCT
TTGTCTTCATCAGCATCGGTTCTGCCCTGGGCTTCAAATACCCGGTGGGGAACAACCAGA
CGGCGGTCCAGGACAACGTGAAGGTGTCGCTGGCCTTCGGGCTGAGCATCGCCACGCTGG
CGCAGAGTGTGGGCCACATCAGCGGCGCCCACCTCAACCCGGCTGTCACACTGGGGCTGC
TGCTCAGCTGCCAGATCAGCATCTTCCGTGCCCTCATGTACATCATCGCCCAGTGCGTGG
GGGCCATCGTCGCCACCGCCATCCTCTCAGGCATCACCTCCTCCCTGACTGGGAACTCGC
TTGGCCGCAATGACCTGGCTGATGGTGTGAACTCGGGCCAGGGCCTGGGCATCGAGATCA
TCGGGACCCTCCAGCTGGTGCTATGCGTGCTGGCTACTACCGACCGGAGGCGCCGTGACC
TTGGTGGCTCAGCCCCCCTTGCCATCGGCCTCTCTGTAGCCCTTGGACACCTCCTGGCTA
TTGACTACACTGGCTGTGGGATTAACCCTGCTCGGTCCTTTGGCTCCGCGGTGATCACAC
ACAACTTCAGCAACCACTGGATTTTCTGGGTGGGGCCATTCATCGGGGGAGCCCTGGCTG
TACTCATCTACGACTTCATCCTGGCCCCACGCAGCAGTGACCTCACAGACCGCGTGAAGG
TGTGGACCAGCGGCCAGGTGGAGGAGTATGACCTGGATGCCGACGACATCAACTCCAGGG
TGGAGATGAAGCCCAAATAGAAGGGGTCTGGCCCGGGCATCCACGTAGGGGGCAGGGGCA
GGGGCGGGCGGAGGGAGGGGAGGGGTGAAATCCATACTGTAGACACTCTGACAAGCTGGC
CAAAGTCACTTCCCCAAGATCTGCCAGACCTGCATGGTCAAGCCTCTTATGGGGGTGTTT
CTATCTCTTTCTTTCTCTTTCTGTTTCCTGGCCTCAGAGCTTCCTGGGGACCAAGATTTA
CCAATTCACCCACTCCCTTGAAGTTGTGGAGGAGGTGAAAGAAAGGGACCCACCTGCTAG
TCGCCCCTCAGAGCATGATGGGAGGTGTGCCAGAAAGTCCCCCCTCGCCCCAAAGTTGCT
CACCGACTCACCTGCGCAAGTGCCTGGGATTCTACCGTAATTGCTTTGTGCCTTTGGGCA
CGGCCCTCCTTCTTTTCCTAACATGCACCTTGCTCCCAATGGTGCTTGGAGGGGGAAGAG
ATCCCAGGAGGTGCAGTGGAGGGGGCAAGCTTTGCTCCTTCAGTTCTGCTTGCTCCCAAG
CCCCTGACCCGCTCGGACTTACTGCCTGACCTTGGAATCGTCCCTATATCAGGGCCTGAG
TGACCTCCTTCTGCAAAGTGGCAGGGACCGGCAGAGCTCTACAGGCCTGCAGCCCCTAAG
TGCAAACACAGCATGGGTCCAGAAGACGTGGTCTAGACCAGGGCTGCTCTTTCCACTTGC
CCTGTGTTCTTTCCCCAGGGGCATGACTGTCGCCACACGCCTCTGTGTACATGTGTGCAG
AGCAGACAGGCTACAAAGCAGAGATCGACAGACAGCCAGGTAGTTGGAACTTTCTGTTCC
CTATGGAGAGGCTTCCCTACACAGGGCCTGCTATTGCAGAATGAAGCCATTTAGAGGGTG
AAGGAGAAATACCCATGTTACTTCTCTGAGTTTTAGTTGGTCTTTCCATCTATCACTGCA
TTATCTTGCTCATTCTTCAGTTCTCTACTCCCTCTTGTCAGTGTAGACACAGGTCACCAT
TATGCTGGTGTATGTTTATCAAAGAGCACTTGAGCTGTCTGAAGCCCAAAGCCTGAGGAC
AGAAAGACCCTGATGCAGGTCAGCCCATGGAGGCAGATGCCCTTGCTGGGCCTGGGGGTT
TTCCAAGCCCTCAGCTGGTCCTGACCAGGATGGAGCAAGCTCTTCCCTTGCTCATGAGCT
CCTGATCAGAGGCATTTGAGCAGCTGAATAACCTGCACAGGCTTGCTGTATGACCCCTGG
CCACAGCCTTCCCTCTGCATTGACCTGGAGGGGAGAGGTCAGCCTTGACCTAATGAGGTA
GCTATAGTTGCAGCCCAAGGACAGTTCAGAGATCAGGATCAGCTTTGAAGGCTGGATTCT
ATCTACATAAGTCCTTTCAATTCCACCAGGGCCAGAGCAGCTCCACCACTGTGCACTTAG
CCATGATGGCAACAGAAACCAAGAGACACAATTACGCAGGTATTTAGAAGCAGAGGGACA
ACCAGAAGGCCCTTAACTATCACCAGTGCATCACATCTGCACACTCTCTTCTCCATTCCC
TAGCAGGAACTTCTAGCTCATTTAACAGATAAAGAAACTGAGGCCCACGGTTTCAGCTAG
ACAATGATTTGGCCAGGCCTAGTAACCAAGGCCCTGTCTCTGGCTACTCCCTGGACCACG
AGGCTGATTCCTCTCATTTCCAGCTTCTCAGTTTCTGCCTGGGCAATGGCCAGGGGCCAG
GAGTGGGGAGAGTTGTGATGGAGGGGAGAGGGGTCACACCCACCCCCTGCCTGGTTCTAG
GCTGCTGCACACCAAGGCCCTGCATCTGTCTGCTCTGCATATATGTCTCTTTGGAGTTGG
AATTTCATTATATGTTAAGAAAATAAAGGAAAATGACTTGTAAGGTC

Protein Sequence

>358 : length: 269
MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLT
GNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK