ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3575

Name

IL7R

Synonym

CD127|CDW127|IL-7R-alpha|IL7RA|ILRA;interleukin 7 receptor;IL7R;interleukin 7 receptor

Definition

CD127 antigen|IL-7 receptor subunit alpha|IL-7R subunit alpha|IL-7RA|interleukin 7 receptor alpha chain|interleukin 7 receptor isoform H5-6|interleukin-7 receptor subunit alpha

Position

5p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Primary immunodeficiency;KEGG PATHWAY;hsa05340

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Disease

Primary immunodeficiency;KEGG DISEASE

Disease

Diabetes mellitus;FunDO

Disease

type 1 diabetes;GAD

Disease

IMMUNE;GAD

Disease

Immune system diseases;KEGG DISEASE

Disease

T-B+ Severe combined immunodeficiencies;KEGG DISEASE;H00091

Disease

Multiple sclerosis;FunDO

Disease

Severe combined immunodeficiency, T-cell negative, B-cell/natural killer cell-positive type;OMIM

Disease

Congenital abnormality;FunDO

Disease

Cancer;FunDO

Disease

Multiple sclerosis;NHGRI

Disease

multiple sclerosis;GAD

Disease

allergy;GAD

Disease

HIV infection;FunDO

Disease

Type 1 diabetes;NHGRI

External Links

Links to cell senescence gene database

3575

Links to epithelial mesenchymal transition gene database

3575

Links to ovarian cancer gene database

3575

Links to endometrial cancer gene database

3575

Links to iHOP

3575

Sequence Information

Nucleotide Sequence

>3575 : length: 4617
ATCTAAGCTTCTCTGTCTTCCTCCCTCCCTCCCTTCCTCTTACTCTCATTCATTTCATAC
ACACTGGCTCACACATCTACTCTCTCTCTCTATCTCTCTCAGAATGACAATTCTAGGTAC
AACTTTTGGCATGGTTTTTTCTTTACTTCAAGTCGTTTCTGGAGAAAGTGGCTATGCTCA
AAATGGAGACTTGGAAGATGCAGAACTGGATGACTACTCATTCTCATGCTATAGCCAGTT
GGAAGTGAATGGATCGCAGCACTCACTGACCTGTGCTTTTGAGGACCCAGATGTCAACAT
CACCAATCTGGAATTTGAAATATGTGGGGCCCTCGTGGAGGTAAAGTGCCTGAATTTCAG
GAAACTACAAGAGATATATTTCATCGAGACAAAGAAATTCTTACTGATTGGAAAGAGCAA
TATATGTGTGAAGGTTGGAGAAAAGAGTCTAACCTGCAAAAAAATAGACCTAACCACTAT
AGTTAAACCTGAGGCTCCTTTTGACCTGAGTGTCGTCTATCGGGAAGGAGCCAATGACTT
TGTGGTGACATTTAATACATCACACTTGCAAAAGAAGTATGTAAAAGTTTTAATGCACGA
TGTAGCTTACCGCCAGGAAAAGGATGAAAACAAATGGACGCATGTGAATTTATCCAGCAC
AAAGCTGACACTCCTGCAGAGAAAGCTCCAACCGGCAGCAATGTATGAGATTAAAGTTCG
ATCCATCCCTGATCACTATTTTAAAGGCTTCTGGAGTGAATGGAGTCCAAGTTATTACTT
CAGAACTCCAGAGATCAATAATAGCTCAGGGGAGATGGATCCTATCTTACTAACCATCAG
CATTTTGAGTTTTTTCTCTGTCGCTCTGTTGGTCATCTTGGCCTGTGTGTTATGGAAAAA
AAGGATTAAGCCTATCGTATGGCCCAGTCTCCCCGATCATAAGAAGACTCTGGAACATCT
TTGTAAGAAACCAAGAAAAAATTTAAATGTGAGTTTCAATCCTGAAAGTTTCCTGGACTG
CCAGATTCATAGGGTGGATGACATTCAAGCTAGAGATGAAGTGGAAGGTTTTCTGCAAGA
TACGTTTCCTCAGCAACTAGAAGAATCTGAGAAGCAGAGGCTTGGAGGGGATGTGCAGAG
CCCCAACTGCCCATCTGAGGATGTAGTCATCACTCCAGAAAGCTTTGGAAGAGATTCATC
CCTCACATGCCTGGCTGGGAATGTCAGTGCATGTGACGCCCCTATTCTCTCCTCTTCCAG
GTCCCTAGACTGCAGGGAGAGTGGCAAGAATGGGCCTCATGTGTACCAGGACCTCCTGCT
TAGCCTTGGGACTACAAACAGCACGCTGCCCCCTCCATTTTCTCTCCAATCTGGAATCCT
GACATTGAACCCAGTTGCTCAGGGTCAGCCCATTCTTACTTCCCTGGGATCAAATCAAGA
AGAAGCATATGTCACCATGTCCAGCTTCTACCAAAACCAGTGAAGTGTAAGAAACCCAGA
CTGAACTTACCGTGAGCGACAAAGATGATTTAAAAGGGAAGTCTAGAGTTCCTAGTCTCC
CTCACAGCACAGAGAAGACAAAATTAGCAAAACCCCACTACACAGTCTGCAAGATTCTGA
AACATTGCTTTGACCACTCTTCCTGAGTTCAGTGGCACTCAACATGAGTCAAGAGCATCC
TGCTTCTACCATGTGGATTTGGTCACAAGGTTTAAGGTGACCCAATGATTCAGCTATTTA
AAAAAAAAAGAGGAAAGAATGAAAGAGTAAAGGAAATGATTGAGGAGTGAGGAAGGCAGG
AAGAGAGCATGAGAGGAAAGAAAGAAAGGAAAATAAAAAATGATAGTTGCCATTATTAGG
ATTTAATATATATCCAGTGCTTTGCAAGTGCTCTGCGCACCTTGTCTCACTCCATCCTGA
CAATAATCCTGGGAGGTGTGTGCAATTACTACGACTACTCTCTTTTTTATAGATCATTAA
ATTCAGAACTAAGGAGTTAAGTAACTTGTCCAAGTTGTTCACACAGTGAAGGGAGGGGCC
AAGATATGATGGCTGGGAGTCTAATTGCAGTTCCCTGAGCCATGTGCCTTTCTCTTCACT
GAGGACTGCCCCATTCTTGAGTGCCAAACGTCACTAGTAACAGGGTGTGCCTAGATAATT
TATGATCCAAACTGAGTCAGTTTGGAAAGTGAAAGGGAAACTTACATATAATCCCTCCGG
GACAATGAGCAAAAACTAGGACTGTCCCCAGACAAATGTGAACATACATATCATCACTTA
AATTAAAATGGCTATGAGAAAGAAAGAGGGGGAGAAACAGTCTTGCGGGTGTGAAGTCCC
ATGACCAGCCATGTCAAAAGAAGGTAAAGAAGTCAAGAAAAAGCCATGAAGCCCATTTGG
TTTCATTTTTCTGAAAATAGGCTCAAGAGGGAATAAATTAGAAACTCACAATTTCTCTTG
TTTGTTACCAAGACAGTGATTCTCTTGCTGCTACCACCCAACTGCATCCGTCCATGATCT
CAGAGGAAACTGTCGCTGACCCTGGACATGGGTACGTTTGACGAGTGAGAGGAGGCATGA
CCCCTCCCATGTGTATAGACACTACCCCAACCTAAATTCATCCCTAAATTGTCCCAAGTT
CTCCAGCAATAGAGGCTGCCACAAACTTCAGGGAGAAAGAGTTACAAGTACATGCAATGA
GTGAACTGACTGTGGCTACAATCTTGAAGATATACGGAAGAGACGTATTATTAATGCTTG
ACATATATCATCTTGCCTTTCTTGGTCTAGACTGACTTCTAATGACTAACTCAAAGTCAA
GGCAACTGAGTAATGTCAGCTCAGCAAAGTGCAGCAAACCCATCTCCCACAGGCCTCCAA
ACCCTGGCTGTTCACAGAACCACAAAGGGCAGATGCTGCACAGAAAACTAGAGAAGGGGT
CATAGGTTCATGGTTTTGTTTGAGATTTGTTGCTACTGTTTTTCTGTTTTGAATTTTCTT
CTTTGTTCTGTTTTTACTTTATTTAGGGGGACTAGGTGTTTCTGATATTTTAGTTTTCTT
GTTTGTTTTGTTTTGTGTTGTCTGTGAATGGGGTTTTAACTGTGGATGAATGGACCTTAT
CTGTTGGCTTAAAGGACTGGTAAGATCAGACCATCTTATTCTTCAGGTGAATGTTTTACT
TTCCAAAGTGCTCTCCTCTGCACCAGCAGTAATAAATACAATGCCATAATCCCTTAGGTT
TGCCTAGTGCTTTTGCAATTTTCAAAGCACTTCCATAAGCATTCCTTCCACCTCCTTGAT
AGGCATTTATGGAAAGCCTGCTACATGTCAATCATACTGTTAGGCACAGGGGACCTAAAG
ACACATAAAAGGATGGCATTCTGCCTCATAAATTGCAAAACCTAATGAAAGTGACTGCTT
GGTAAACAAATTATTATTATATTATAAAATGCTATAAAAGAGCCATATTGAAAGTGCCCT
GTTGGAGACAGGGCAAATGCCACAAAAATGATGTAAATTTACATGGAGGAAAAGTAGAAT
CTGCCTGGTTTGTAGGCAGCAGAAGACATTTTTCATCAGTGGGCAGGTGTTCTTTACCTT
TTGTAGAAATGGGAGTCAAGTCTCAAATAGGAGGCTCCACAAAATCTCATGCCAGGTCTC
TGATACCTTATTCACAGAAGTTCTTTGAAGTATTTATTGTTATTTTCTTTGACTTATGGG
AAAACTGGGACACAGGAAGACAGGTAAATTACCCAACCTCACACGTTAAGTCAGAACTGG
GAGCCATAATTTTGTATCCCTGGTATAAATAGACAATCTCTTGAAGAAATGAAGAGATGA
CCATAGAAAAACATCGAGATATCTCCAGCTCTAAAATCCTTTGTTTCAATGTTGTTTGGC
ATATGTTATCTTTGGAATTTAGTGTCTGAGCCTCTGTCTGTTACTGTAGTATTTAAAATG
CATGTATTATAATCATATAATCATAACTGCTGTTAATTCTTGATTATATACCTAGGGACA
ATGTGTAATGTAAGATTACTAATTGGTTCTGCCCAATCTCCTTTCAGATTTTATTAGGAA
AAAAAAATAAACCTCCTGATCGGAGACAATGTATTAATCAGAAGTGTAAACTGCCAGTTC
TATATAGCATGAAATGAAAAGACAGCTAATTTGGTCCAACAAACATGACTGGGTCTAGGG
CACCCAGGCTGATTCAGCTGATTTCCTACCAGCCTTTGCCTCTTCCTTCAATGTGGTTTC
CATGGGAATTTGCTTCAGAAAAGCCAAGTATGGGCTGTTCAGAGGTGCACACCTGCATTT
TCTTAGCTCTTCTAGAGGGGCTAAGAGACTTGGTACGGGCCAGGAAGAATATGTGGCAGA
GCTCCTGGAAATGATGCAGATTAGGTGGCATTTTTGTCAGCTCTGTGGTTTATTGTTGGG
ACTATTCTTTAAAATATCCATTGTTCACTACAGTGAAGATCTCTGATTTAACCGTGTACT
ATCCACATGCATTACAAACATTTCGCAGAGCTGCTTAGTATATAAGCGTACAATGTATGT
AATAACCATCTCATATTTAATTAAATGGTATAGAAGAACAAAAAAAAAAAAAAAAAA

Protein Sequence

>3575 : length: 459
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTH
VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ