ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3480

Name

IGF1R

Synonym

CD221|IGFIR|IGFR|JTK13;insulin-like growth factor 1 receptor;IGF1R;insulin-like growth factor 1 receptor

Definition

IGF-I receptor|insulin-like growth factor I receptor|soluble IGF1R variant 1|soluble IGF1R variant 2

Position

15q26.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

IGF1 pathway;PID Curated;200084

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

the igf-1 receptor and longevity;PID BioCarta;100115

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade;PANTHER;P00032

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

multiple antiapoptotic pathways from igf-1r signaling lead to bad phosphorylation;PID BioCarta;100135

Disease

Height;NHGRI

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Bacteremia;GAD

Disease

Insulin-like growth factor I, resistance to;OMIM

Disease

breast cancer;GAD

Disease

Oral cancer;FunDO

Disease

Depression;FunDO

Disease

Graves' disease;FunDO

Disease

Synovial sarcoma;KEGG DISEASE;H00050

Disease

NEUROLOGICAL;GAD

Disease

INFECTION;GAD

Disease

Malignant pleural mesothelioma;KEGG DISEASE;H00015

Disease

Retinal disease;FunDO

Disease

premature pubarche;GAD

Disease

CARDIOVASCULAR;GAD

Disease

CANCER;GAD

Disease

blood pressure, arterial;GAD

Disease

Sickle cell disease;FunDO

Disease

Birth Weight;GAD

Disease

Cancer;FunDO

Disease

REPRODUCTION;GAD

Disease

Cancers;KEGG DISEASE

Disease

Osteoporosis;FunDO

Disease

Alzheimer's disease dementia;GAD

Disease

Infertility;FunDO

Disease

Septicemia;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to cell senescence gene database

3480

Links to epithelial mesenchymal transition gene database

3480

Links to ovarian cancer gene database

3480

Links to endometrial cancer gene database

3480

Links to iHOP

3480

Sequence Information

Nucleotide Sequence

>3480 : length: 12262
AGTGTGTGGCAGCGGCGGCGGCGGCGCGGCGAGGCTGGGGCTCTTGTTTACCAGCATTAA
CTCCGCTGAGCGGAAAAAAAAAGGGAAAAAACCCGAGGAGGAGCGAGCGCACCAGGCGAA
CTCGAGAGAGGCGGGAGAGCGAGAGGGACGCCGCCAGCGAGCCTGCCCACGGCCGGCGCT
CGCAGACCCTCGGCCCCGCTCCCCGGATCCCCCCGCGCCCTCCACGCCCCTCCCGCGCGG
GGGCAGCTCCACGGCGCGCCTCGCCTCGGCTGTGACCTTCAGCGAGCCGGAGCCCCCGCG
CAGAGCAGGCGGCGGCGGGCGGGGGCCGGGCGGGGGCCGGCGCGGGGCGGGCGGCGGCGC
AGAGCCGGGCGGCGCGGCGGGAGTGCTGAGCGCGGCGCGGCCGGCCCGCCGCTTTGTGTG
TGTCCTGGATTTGGGAAGGAGCTCGCCGCGGCGGCGGCGGCGCTGAGGGAGGAGGCGGCG
GCGAGCGGAGCCAGGAGGAGGAGGAGGAGGGGGAGCCGCTCATTCATTTTGACTCCGCGT
TTCTGCCCCTCGCCGGCCTCGCCTGTGACCCGGACTTCGGGGCGATCTTGCGAACTGCGT
CGCGCCCTCCCGCGGCGGAAGCTCGGGCGTCCGGCCGCCTCCCGCGCGGCCAGGGCCGGG
CTTGTTTTTCCTCGCCTAGGCAGATTTGGGCTTTGCCCCCTTTCTTTGCAGTTTTCCCCC
CTTCCTGCCTCTCCGGGTTTGAAAATGGAGGCCGACGACGCCGACAGCCCGCCCCGGCGC
GCCTCGGGTTCCCGACTCCGCCGAGCCCTGGGCCGCTGCTGCCGGCGCTGAGGGGCCGCC
CCGCGCCGCCCGCCCCGTCCGCGCACCCGGAGGGCCCCGGCGGCGCCGCCTTCGGAGTAT
TGTTTCCTTCGCCCTTGTTTTTGGAGGGGGAGCGAAGACTGAGTTTGAGACTTGTTTCCT
TTCATTTCCTTTTTTTCTTTTCTTTTCTTTTTTTTTTTTTTTTTTTTTTTTGAGAAAGGG
GAATTTCATCCCAAATAAAAGGAATGAAGTCTGGCTCCGGAGGAGGGTCCCCGACCTCGC
TGTGGGGGCTCCTGTTTCTCTCCGCCGCGCTCTCGCTCTGGCCGACGAGTGGAGAAATCT
GCGGGCCAGGCATCGACATCCGCAACGACTATCAGCAGCTGAAGCGCCTGGAGAACTGCA
CGGTGATCGAGGGCTACCTCCACATCCTGCTCATCTCCAAGGCCGAGGACTACCGCAGCT
ACCGCTTCCCCAAGCTCACGGTCATTACCGAGTACTTGCTGCTGTTCCGAGTGGCTGGCC
TCGAGAGCCTCGGAGACCTCTTCCCCAACCTCACGGTCATCCGCGGCTGGAAACTCTTCT
ACAACTACGCCCTGGTCATCTTCGAGATGACCAATCTCAAGGATATTGGGCTTTACAACC
TGAGGAACATTACTCGGGGGGCCATCAGGATTGAGAAAAATGCTGACCTCTGTTACCTCT
CCACTGTGGACTGGTCCCTGATCCTGGATGCGGTGTCCAATAACTACATTGTGGGGAATA
AGCCCCCAAAGGAATGTGGGGACCTGTGTCCAGGGACCATGGAGGAGAAGCCGATGTGTG
AGAAGACCACCATCAACAATGAGTACAACTACCGCTGCTGGACCACAAACCGCTGCCAGA
AAATGTGCCCAAGCACGTGTGGGAAGCGGGCGTGCACCGAGAACAATGAGTGCTGCCACC
CCGAGTGCCTGGGCAGCTGCAGCGCGCCTGACAACGACACGGCCTGTGTAGCTTGCCGCC
ACTACTACTATGCCGGTGTCTGTGTGCCTGCCTGCCCGCCCAACACCTACAGGTTTGAGG
GCTGGCGCTGTGTGGACCGTGACTTCTGCGCCAACATCCTCAGCGCCGAGAGCAGCGACT
CCGAGGGGTTTGTGATCCACGACGGCGAGTGCATGCAGGAGTGCCCCTCGGGCTTCATCC
GCAACGGCAGCCAGAGCATGTACTGCATCCCTTGTGAAGGTCCTTGCCCGAAGGTCTGTG
AGGAAGAAAAGAAAACAAAGACCATTGATTCTGTTACTTCTGCTCAGATGCTCCAAGGAT
GCACCATCTTCAAGGGCAATTTGCTCATTAACATCCGACGGGGGAATAACATTGCTTCAG
AGCTGGAGAACTTCATGGGGCTCATCGAGGTGGTGACGGGCTACGTGAAGATCCGCCATT
CTCATGCCTTGGTCTCCTTGTCCTTCCTAAAAAACCTTCGCCTCATCCTAGGAGAGGAGC
AGCTAGAAGGGAATTACTCCTTCTACGTCCTCGACAACCAGAACTTGCAGCAACTGTGGG
ACTGGGACCACCGCAACCTGACCATCAAAGCAGGGAAAATGTACTTTGCTTTCAATCCCA
AATTATGTGTTTCCGAAATTTACCGCATGGAGGAAGTGACGGGGACTAAAGGGCGCCAAA
GCAAAGGGGACATAAACACCAGGAACAACGGGGAGAGAGCCTCCTGTGAAAGTGACGTCC
TGCATTTCACCTCCACCACCACGTCGAAGAATCGCATCATCATAACCTGGCACCGGTACC
GGCCCCCTGACTACAGGGATCTCATCAGCTTCACCGTTTACTACAAGGAAGCACCCTTTA
AGAATGTCACAGAGTATGATGGGCAGGATGCCTGCGGCTCCAACAGCTGGAACATGGTGG
ACGTGGACCTCCCGCCCAACAAGGACGTGGAGCCCGGCATCTTACTACATGGGCTGAAGC
CCTGGACTCAGTACGCCGTTTACGTCAAGGCTGTGACCCTCACCATGGTGGAGAACGACC
ATATCCGTGGGGCCAAGAGTGAGATCTTGTACATTCGCACCAATGCTTCAGTTCCTTCCA
TTCCCTTGGACGTTCTTTCAGCATCGAACTCCTCTTCTCAGTTAATCGTGAAGTGGAACC
CTCCCTCTCTGCCCAACGGCAACCTGAGTTACTACATTGTGCGCTGGCAGCGGCAGCCTC
AGGACGGCTACCTTTACCGGCACAATTACTGCTCCAAAGACAAAATCCCCATCAGGAAGT
ATGCCGACGGCACCATCGACATTGAGGAGGTCACAGAGAACCCCAAGACTGAGGTGTGTG
GTGGGGAGAAAGGGCCTTGCTGCGCCTGCCCCAAAACTGAAGCCGAGAAGCAGGCCGAGA
AGGAGGAGGCTGAATACCGCAAAGTCTTTGAGAATTTCCTGCACAACTCCATCTTCGTGC
CCAGACCTGAAAGGAAGCGGAGAGATGTCATGCAAGTGGCCAACACCACCATGTCCAGCC
GAAGCAGGAACACCACGGCCGCAGACACCTACAACATCACCGACCCGGAAGAGCTGGAGA
CAGAGTACCCTTTCTTTGAGAGCAGAGTGGATAACAAGGAGAGAACTGTCATTTCTAACC
TTCGGCCTTTCACATTGTACCGCATCGATATCCACAGCTGCAACCACGAGGCTGAGAAGC
TGGGCTGCAGCGCCTCCAACTTCGTCTTTGCAAGGACTATGCCCGCAGAAGGAGCAGATG
ACATTCCTGGGCCAGTGACCTGGGAGCCAAGGCCTGAAAACTCCATCTTTTTAAAGTGGC
CGGAACCTGAGAATCCCAATGGATTGATTCTAATGTATGAAATAAAATACGGATCACAAG
TTGAGGATCAGCGAGAATGTGTGTCCAGACAGGAATACAGGAAGTATGGAGGGGCCAAGC
TAAACCGGCTAAACCCGGGGAACTACACAGCCCGGATTCAGGCCACATCTCTCTCTGGGA
ATGGGTCGTGGACAGATCCTGTGTTCTTCTATGTCCAGGCCAAAACAGGATATGAAAACT
TCATCCATCTGATCATCGCTCTGCCCGTCGCTGTCCTGTTGATCGTGGGAGGGTTGGTGA
TTATGCTGTACGTCTTCCATAGAAAGAGAAATAACAGCAGGCTGGGGAATGGAGTGCTGT
ATGCCTCTGTGAACCCGGAGTACTTCAGCGCTGCTGATGTGTACGTTCCTGATGAGTGGG
AGGTGGCTCGGGAGAAGATCACCATGAGCCGGGAACTTGGGCAGGGGTCGTTTGGGATGG
TCTATGAAGGAGTTGCCAAGGGTGTGGTGAAAGATGAACCTGAAACCAGAGTGGCCATTA
AAACAGTGAACGAGGCCGCAAGCATGCGTGAGAGGATTGAGTTTCTCAACGAAGCTTCTG
TGATGAAGGAGTTCAATTGTCACCATGTGGTGCGATTGCTGGGTGTGGTGTCCCAAGGCC
AGCCAACACTGGTCATCATGGAACTGATGACACGGGGCGATCTCAAAAGTTATCTCCGGT
CTCTGAGGCCAGAAATGGAGAATAATCCAGTCCTAGCACCTCCAAGCCTGAGCAAGATGA
TTCAGATGGCCGGAGAGATTGCAGACGGCATGGCATACCTCAACGCCAATAAGTTCGTCC
ACAGAGACCTTGCTGCCCGGAATTGCATGGTAGCCGAAGATTTCACAGTCAAAATCGGAG
ATTTTGGTATGACGCGAGATATCTATGAGACAGACTATTACCGGAAAGGAGGGAAAGGGC
TGCTGCCCGTGCGCTGGATGTCTCCTGAGTCCCTCAAGGATGGAGTCTTCACCACTTACT
CGGACGTCTGGTCCTTCGGGGTCGTCCTCTGGGAGATCGCCACACTGGCCGAGCAGCCCT
ACCAGGGCTTGTCCAACGAGCAAGTCCTTCGCTTCGTCATGGAGGGCGGCCTTCTGGACA
AGCCAGACAACTGTCCTGACATGCTGTTTGAACTGATGCGCATGTGCTGGCAGTATAACC
CCAAGATGAGGCCTTCCTTCCTGGAGATCATCAGCAGCATCAAAGAGGAGATGGAGCCTG
GCTTCCGGGAGGTCTCCTTCTACTACAGCGAGGAGAACAAGCTGCCCGAGCCGGAGGAGC
TGGACCTGGAGCCAGAGAACATGGAGAGCGTCCCCCTGGACCCCTCGGCCTCCTCGTCCT
CCCTGCCACTGCCCGACAGACACTCAGGACACAAGGCCGAGAACGGCCCCGGCCCTGGGG
TGCTGGTCCTCCGCGCCAGCTTCGACGAGAGACAGCCTTACGCCCACATGAACGGGGGCC
GCAAGAACGAGCGGGCCTTGCCGCTGCCCCAGTCTTCGACCTGCTGATCCTTGGATCCTG
AATCTGTGCAAACAGTAACGTGTGCGCACGCGCAGCGGGGTGGGGGGGGAGAGAGAGTTT
TAACAATCCATTCACAAGCCTCCTGTACCTCAGTGGATCTTCAGAACTGCCCTTGCTGCC
CGCGGGAGACAGCTTCTCTGCAGTAAAACACATTTGGGATGTTCCTTTTTTCAATATGCA
AGCAGCTTTTTATTCCCTGCCCAAACCCTTAACTGACATGGGCCTTTAAGAACCTTAATG
ACAACACTTAATAGCAACAGAGCACTTGAGAACCAGTCTCCTCACTCTGTCCCTGTCCTT
CCCTGTTCTCCCTTTCTCTCTCCTCTCTGCTTCATAACGGAAAAATAATTGCCACAAGTC
CAGCTGGGAAGCCCTTTTTATCAGTTTGAGGAAGTGGCTGTCCCTGTGGCCCCATCCAAC
CACTGTACACACCCGCCTGACACCGTGGGTCATTACAAAAAAACACGTGGAGATGGAAAT
TTTTACCTTTATCTTTCACCTTTCTAGGGACATGAAATTTACAAAGGGCCATCGTTCATC
CAAGGCTGTTACCATTTTAACGCTGCCTAATTTTGCCAAAATCCTGAACTTTCTCCCTCA
TCGGCCCGGCGCTGATTCCTCGTGTCCGGAGGCATGGGTGAGCATGGCAGCTGGTTGCTC
CATTTGAGAGACACGCTGGCGACACACTCCGTCCATCCGACTGCCCCTGCTGTGCTGCTC
AAGGCCACAGGCACACAGGTCTCATTGCTTCTGACTAGATTATTATTTGGGGGAACTGGA
CACAATAGGTCTTTCTCTCAGTGAAGGTGGGGAGAAGCTGAACCGGCTTCCCTGCCCTGC
CTCCCCAGCCCCCTGCCCAACCCCCAAGAATCTGGTGGCCATGGGCCCCGAAGCAGCCTG
GCGGACAGGCTTGGAGTCAAGGGGCCCCATGCCTGCTTCTCTCCCAGCCCCAGCTCCCCC
GCCCGCCCCCAAGGACACAGATGGGAAGGGGTTTCCAGGGACTCAGCCCCACTGTTGATG
CAGGTTTGCAAGGAAAGAAATTCAAACACCACAACAGCAGTAAGAAGAAAAGCAGTCAAT
GGATTCAAGCATTCTAAGCTTTGTTGACATTTTCTCTGTTCCTAGGACTTCTTCATGGGT
CTTACAGTTCTATGTTAGACCATGAAACATTTGCATACACATCGTCTTTAATGTCACTTT
TATAACTTTTTTACGGTTCAGATATTCATCTATACGTCTGTACAGAAAAAAAAAAGCTGC
TATTTTTTTTGTTCTTGATCTTTGTGGATTTAATCTATGAAAACCTTCAGGTCCACCCTC
TCCCCTTTCTGCTCACTCCAAGAAACTTCTTATGCTTTGTACTAGAGTGCGTGACTTTCT
TCCTCTTTTCCCGGTAATGGATACTTCTATCACATAATTTGCCATGAACTGTTGGATGCC
TTTTTATAAATACATCCCCCATCCCTGCTCCCACCTGCCCCTTTAGTTGTTTTCTAACCC
GTAGGCTCTCTGGGCACGAGGCAGAAAGCAGGCCGGGCACCCATCCTGAGAGGGCCGCGC
TCCTCTCCCCAGCCTGCCCTCACAGCATTGGAGCCTGTTACAGTGCAAGACATGATACAA
ACTCAGGTCAGAAAAACAAAGGTTAAATATTTCACACGTCTTTGTTCAGTGTTTCCACTC
ACCGTGGTTGAGAAGCCTCACCCTCTCTTTCCCTTGCCTTTGCTTAGGTTGTGACACACA
TATATATATATTTTTTTAATTCTTGGGTACAACAGCAGTGTTAACCGCAGACACTAGGCA
TTTGGATTACTATTTTTCTTAATGGCTATTTAATCCTTCCATCCCACGAAAAACAGCTGC
TGAGTCCAAGGGAGCAGCAGAGCGTGGTCCGGCAGGGCCTGTTGTGGCCCTCGCCACCCC
CCTCACCGGACCGACTGACCTGTCTTTGGAACCAGAACATCCCAAGGGAACTCCTTCGCA
CTGGCGTTGAGTGGGACCCCGGGATCCAGGCTGGCCCAGGGCGGCACCCTCAGGGCTGTG
CCCGCTGGAGTGCTAGGTGGAGGCAGCACAGACGCCACGGTGGCCCAAGAGCCCCTTTGC
TTCTTGCTGGGGGACCAGGGCTGTGGTGCTGGCCCACTTTCCCTCGGCCAGGAATCCAGG
TCCTTGGGGCCCAGGGGTCTTGTCTTGTTTCATTTTTAGCACTTCTCACCAGAGAGATGA
CAGCACAAGAGTTGCTTCTGGGATAGAAATGTTTAGGAGTAAGAACAAAGCTGGGATACG
GTGATTGCTAGTTGTGACTGAAGATTCAACACAGAAAAGAAAGTTTATACGGCTTTTTTG
CTGGTCAGCAGTTTGTCCCACTGCTTTCTCTAGTCTCTATCCCATAGCGTGTTCCCTTTA
AAAAAAAAAAAAAGGTATTATATGTAGGAGTTTTCTTTTAATTTATTTTGTGATAAATTA
CCAGTTTCAATCACTGTAGAAAAGCCCCATTATGAATTTAAATTTCAAGGAAAGGGTGTG
TGTGTGTGTATGTGTGGGGTGTGTGTGTGTGAGAGTGATGGGACAGTTCTTGATTTTTTG
GGTTTTTTTTCCCCCAAACATTTATCTACCTCACTCTTATTTTTTATATGTGTATATAGA
CAAAAGAATACATCTCACCTTTCTCAGCACCTGACAATAGGCCGTTGATACTGGTAACCT
CATCCACGCCACAGGCGCCACACCCAGGTGATGCAGGGGGAAGCCAGGCTGTATTCCGGG
GTCAAAGCAACACTAACTCACCTCTCTGCTCATTTCAGACAGCTTGCCTTTTTCTGAGAT
GTCCTGTTTTGTGTTGCTTTTTTTGTTTTGTTTTCTATCTTGGTTTCCACCAAGGTGTTA
GATTTCTCCTCCTCCTAGCCAGGTGGCCCTGTGAGGCCAACGAGGGCACCAGAGCACACC
TGGGGGAGCCACCAGGCTGTCCCTGGCTGGTTGTCTTTGGAACAAACTGCTTCTGTGCAG
ATGGAATGACCAACACATTTCGTCCTTAAGAGAGCAGTGGTTCCTCAGGTTCTGAGGAGA
GGAAGGTGTCCAGGCAGCACCATCTCTGTGCGAATCCCCAGGGTAAAGGCGTGGGGCATT
GGGTTTGCTCCCCTTGCTGCTGCTCCATCCCTGCAGGAGGCTCGCGCTGAGGCAGGACCG
TGCGGCCATGGCTGCTGCATTCATTGAGCACAAAGGTGCAGCTGCAGCAGCAGCTGGAGA
GCAAGAGTCACCCAGCCTGTGCGCCAGAATGCAGAGGCTCCTGACCTCACAGCCAGTCCC
TGATAGAACACACGCAGGAGCAGAGTCCCCTCCCCCTCCAGGCTGCCCTCTCAACTTCTC
CCTCACCTCCTTCCCTAGGGGTAGACAGAGATGTACCAAACCTTCCGGCTGGAAAGCCCA
GTGGCCGGCGCCGAGGCTCGTGGCGTCACGCCCCCCCCGCCAGGGCTGTACCTCCGTCTC
CCTGGTCCTGCTGCTCACAGGACAGACGGCTCGCTCCCCTCTTCCAGCAGCTGCTCTTAC
AGGCACTGATGATTTCGCTGGGAAGTGTGGCGGGCAGCTTTGCCTAAGCGTGGATGGCTC
CTCGGCAATTCCAGCCTAAGTGAAGGCGCTCAGGAGCCTCCTGCTGGAACGCGACCCATC
TCTCCCAGGACCCCGGGGATCTTAAGGTCATTGAGAAATACTGTTGGATCAGGGTTTTGT
TCTTCCACACTGTAGGTGACCCCTTGGAATAACGGCCTCTCCTCTCGTGCACATACCTAC
CGGTTTCCACAACTGGATTTCTACAGATCATTCAGCTGGTTATAAGGGTTTTGTTTAAAC
TGTCCGAGTTACTGATGTCATTTTGTTTTTGTTTTATGTAGGTAGCTTTTAAGTAGAAAA
CACTAACAGTGTAGTGCCCATCATAGCAAATGCTTCAGAAACACCTCAATAAAAGAGAAA
ACTTGGCTTGTGTGATGGTGCAGTCACTTTACTGGACCAACCCACCCACCTTGACTATAC
CAAGGCATCATCTATCCACAGTTCTAGCCTAACTTCATGCTGATTTCTCTGCCTCTTGAT
TTTTCTCTGTGTGTTCCAAATAATCTTAAGCTGAGTTGTGGCATTTTCCATGCAACCTCC
TTCTGCCAGCAGCTCACACTGCTTGAAGTCATATGAACCACTGAGGCACATCATGGAATT
GATGTGAGCATTAAGACGTTCTCCCACACAGCCCTTCCCTGAGGCAGCAGGAGCTGGTGT
GTACTGGAGACACTGTTGAACTTGATCAAGACCCAGACCACCCCAGGTCTCCTTCGTGGG
ATGTCATGACGTTTGACATACCTTTGGAACGAGCCTCCTCCTTGGAAGATGGAAGACCGT
GTTCGTGGCCGACCTGGCCTCTCCTGGCCTGTTTCTTAAGATGCGGAGTCACATTTCAAT
GGTACGAAAAGTGGCTTCGTAAAATAGAAGAGCAGTCACTGTGGAACTACCAAATGGCGA
GATGCTCGGTGCACATTGGGGTGCTTTGGGATAAAAGATTTATGAGCCAACTATTCTCTG
GCACCAGATTCTAGGCCAGTTTGTTCCACTGAAGCTTTTCCCACAGCAGTCCACCTCTGC
AGGCTGGCAGCCGAATGGCTTGCCAGTGGCTCTGTGGCAAGATCACACTGAGATCGATGG
GTGAGAAGGCTAGGATGCTTGTCTAGTGTTCTTAGCTGTCACGTTGGCTCCTTCCAGGGT
GGCCAGACGGTGTTGGCCACTCCCTTCTAAAACACAGGCGCCCTCCTGGTGACAGTGACC
CGCCGTGGTATGCCTTGGCCCATTCCAGCAGTCCCAGTTATGCATTTCAAGTTTGGGGTT
TGTTCTTTTCGTTAATGTTCCTCTGTGTTGTCAGCTGTCTTCATTTCCTGGGCTAAGCAG
CATTGGGAGATGTGGACCAGAGATCCACTCCTTAAGAACCAGTGGCGAAAGACACTTTCT
TTCTTCACTCTGAAGTAGCTGGTGGTACAAATGAGAACTTCAAGAGAGGATGTTATTTAG
ACTGAACCTCTGTTGCCAGAGATGCTGAAGATACAGACCTTGGACAGGTCAGAGGGTTTC
ATTTTTGGCCTTCATCTTAGATGACTGGTTGCGTCATTTGGAGAAGTGAGTGCTCCTTGA
TGGTGGAATGACCGGGTGGTGGGTACAGAACCATTGTCACAGGGATCCTGGCACAGAGAA
GAGTTACGAGCAGCAGGGTGCAGGGCTTGGAAGGAATGTGGGCAAGGTTTTGAACTTGAT
TGTTCTTGAAGCTATCAGACCACATCGAGGCTCAGCAGTCATCCGTGGGCATTTGGTTTC
AACAAAGAAACCTAACATCCTACTCTGGAAACTGATCTCGGAGTTAAGGCGAATTGTTCA
AGAACACAAACTACATCGCACTCGTCAGTTGTCAGTTCTGGGGCATGACTTTAGCGTTTT
GTTTCTGCGAGAACATAACGATCACTCATTTTTATGTCCCACGTGTGTGTGTCCGCATCT
TTCTGGTCAACATTGTTTTAACTAGTCACTCATTAGCGTTTTCAATAGGGCTCTTAAGTC
CAGTAGATTACGGGTAGTCAGTTGACGAAGATCTGGTTTACAAGAACTAATTAAATGTTT
CATTGCATTTTTGTAAGAACAGAATAATTTTATAAAATGTTTGTAGTTTATAATTGCCGA
AAATAATTTAAAGACACTTTTTTTTTCTCTGTGTGTGCAAATGTGTGTTTGTGATCCATT
TTTTTTTTTTTTTTTTAGGACACCTGTTTACTAGCTAGCTTTACAATATGCCAAAAAAGG
ATTTCTCCCTGACCCCATCCGTGGTTCACCCTCTTTTCCCCCCATGCTTTTTGCCCTAGT
TTATAACAAAGGAATGATGATGATTTAAAAAGTAGTTCTGTATCTTCAGTATCTTGGTCT
TCCAGAACCCTCTGGTTGGGAAGGGGATCATTTTTTACTGGTCATTTCCCTTTGGAGTGT
AGCTACTTTAACAGATGGAAAGAACCTCATTGGCCATGGAAACAGCCGAGGTGTTGGAGC
CCAGCAGTGCATGGCACCGTTCGGCATCTGGCTTGATTGGTCTGGCTGCCGTCATTGTCA
GCACAGTGCCATGGACATGGGAAGACTTGACTGCACAGCCAATGGTTTTCATGATGATTA
CAGCATACACAGTGATCACATAAACGATGACAGCTATGGGGCACACAGGCCATTTGCTTA
CATGCCTCGTATCATGACTGATTACTGCTTTGTTAGAACACAGAAGAGACCCTATTTTAT
TTAAGGCAGAACCCCGAAGATACGTATTTCCAATACAGAAAAGAATTTTTAATAAAAACT
ATAACATACACAAAAATTGGTTTTAAAGTTGACTCCACTTCCTCTAACTCCAGTGGATTG
TTGGCCATGTCTCCCCAACTCCACAATATCTCTATCATGGGAAACACCTGGGGTTTTTGC
GCTACATAGGAGAAAGATCTGGAAACTATTTGGGTTTTGTTTTCAACTTTTCATTTGGAT
GTTTGGCGTTGCACACACACATCCACCGGTGGAAGAGACGCCCGGTGAAAACACCTGTCT
GCTTTCTAAGCCAGTGAGGTTGAGGTGAGAGGTTTGCCAGAGTTTGTCTACCTCTGGGTA
TCCCTTTGTCTGGGATAAAAAAAATCAAACCAGAAGGCGGGATGGAATGGATGCACCGCA
AATAATGCATTTTCTGAGTTTTCTTGTTAAAAAAAAATTTTTTTAAGTAAGAAAAAAAAA
GGTAATAACATGGCCAATTTGTTACATAAAATGACTTTCTGTGTATAAATTATTCCTAAA
AAATCCTGTTTATATAAAAAATCAGTAGATGAAAAAAATTTCAAAATGTTTTTGTATATT
CTGTTGTAAGAATTTATTCCTGTTATTGCGATATACTCTGGATTCTTTACATAATGGAAA
AAAGAAACTGTCTATTTTGAATGGCTGAAGCTAAGGCAACGTTAGTTTCTCTTACTCTGC
TTTTTTCTAGTAAAGTACTACATGGTTTAAGTTAAATAAAATAATTCTGTATGCAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>3480 : length: 1388
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKSRREQMHIPVCTATWFLSSLAVCPSTC
GKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDR
DFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTK
TIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSL
SFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEI
YRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRD
LISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAV
YVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNG
NLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPC
CACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTA
ADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASN
FVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQREC
VSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIA
LPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKI
TMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNC
HHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEI
ADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWM
SPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPD
MLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPEN
MESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERAL
PLPQSSTC