ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3458

Name

IFNG

Synonym

IFG|IFI;interferon, gamma;IFNG;interferon, gamma

Definition

IFN-gamma|immune interferon|interferon gamma

Position

12q14

Gene Type

protein-coding

Pathways and Diseases

Pathway

Allograft rejection;KEGG PATHWAY;hsa05330

Pathway

ifn gamma signaling pathway;PID BioCarta;100138

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Interferon-gamma signaling pathway;PANTHER;P00035

Pathway

IL12 signaling mediated by STAT4;PID Curated;200197

Pathway

Type I diabetes mellitus;KEGG PATHWAY;hsa04940

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

PDGFR-alpha signaling pathway;PID Curated;200140

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Calcium signaling in the CD4+ TCR pathway;PID Curated;200159

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Regulation of autophagy;KEGG PATHWAY;hsa04140

Pathway

Systemic lupus erythematosus;KEGG PATHWAY;hsa05322

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

no2-dependent il-12 pathway in nk cells;PID BioCarta;100093

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Proteasome;KEGG PATHWAY;hsa03050

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

Antigen processing and presentation;KEGG PATHWAY;hsa04612

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

il12 and stat4 dependent signaling pathway in th1 development;PID BioCarta;100133

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

the 41bb-dependent immune response;PID BioCarta;100257

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

Graft-versus-host disease;KEGG PATHWAY;hsa05332

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

chaperones modulate interferon signaling pathway;PID BioCarta;100016

Disease

Sjogren's syndrome;GAD

Disease

Purpura, Thrombocytopenic, Idiopathic;FunDO

Disease

Nasopharyngeal cancer;FunDO

Disease

longevity;GAD

Disease

Influenza;FunDO

Disease

IMMUNE;GAD

Disease

Multiple myeloma;FunDO

Disease

Alopecia;FunDO

Disease

aplastic anemia, acquired;GAD

Disease

Hyperthyroidism;FunDO

Disease

INFECTION;GAD

Disease

Colon cancer;FunDO

Disease

Cervical cancer;FunDO

Disease

Hepatitis C virus, response to therapy of;OMIM

Disease

hepatitis B;GAD

Disease

Common Cold;GAD

Disease

REPRODUCTION;GAD

Disease

respiratory syncytial virus bronchiolitis;GAD

Disease

smoking cessation;GAD

Disease

RENAL;GAD

Disease

multiple sclerosis;GAD

Disease

Enteritis;FunDO

Disease

Tuberculosis, protection against;OMIM

Disease

AIDS, rapid progression to;OMIM

Disease

brucellosis;GAD

Disease

Atherosclerosis;FunDO

Disease

Lupus erythematosus;FunDO

Disease

Atopic asthma;GAD

Disease

allergic rhinitis;GAD

Disease

Mycobacterium infection, Atypical;FunDO

Disease

breast cancer;GAD

Disease

Graves' disease Hashimoto's thryoiditis;GAD

Disease

parvovirus B19 infection;GAD

Disease

Lung cancer;FunDO

Disease

recurrent pregnancy loss;GAD

Disease

Aplastic anemia;OMIM

Disease

Liver cancer;FunDO

Disease

Ulcerative colitis;FunDO

Disease

Helicobacter infection;FunDO

Disease

Choriocarcinoma;FunDO

Disease

Communicable disease;FunDO

Disease

Hemolytic anemia;FunDO

Disease

Emphysema;FunDO

Disease

Pancreatitis;FunDO

Disease

Graves' disease Hashimoto's thyroiditis;GAD

Disease

Systemic infection;FunDO

Disease

kidney angiomyolipomas;GAD

Disease

Neutropenia;FunDO

Disease

SARS (severe acute respiratory syndrome);GAD

Disease

sepsis;GAD

Disease

Vaccinia;FunDO

Disease

diabetes, type 1;GAD

Disease

Solid tumor;FunDO

Disease

graft-versus-host disease;GAD

Disease

tryptophan catabolism;GAD

Disease

Behcet syndrome;FunDO

Disease

Squamous cell cancer;FunDO

Disease

allograft outcome;GAD

Disease

IGA glomerulonephritis;FunDO

Disease

Uveitis;FunDO

Disease

Abortion;FunDO

Disease

polymyalgia rheumatica;GAD

Disease

birth weight perinatal complications;GAD

Disease

CANCER;GAD

Disease

Ovarian cancer;FunDO

Disease

Allergies and autoimmune diseases;KEGG DISEASE

Disease

leishmaniasis, cutaneous;GAD

Disease

Grave`s disease;GAD

Disease

Arthritis;FunDO

Disease

HEMATOLOGICAL;GAD

Disease

endometriosis;GAD

Disease

Asthma;FunDO

Disease

TSC2 angiomyolipomas, renal, modifier of;OMIM

Disease

AGING;GAD

Disease

Neoplasm metastasis;FunDO

Disease

Prostate cancer;FunDO

Disease

Serous cancer;FunDO

Disease

Anemia;FunDO

Disease

Infection;FunDO

Disease

Leukemia;FunDO

Disease

PHARMACOGENOMIC;GAD

Disease

METABOLIC;GAD

Disease

Ulcerative colitis;NHGRI

Disease

Allograft rejection;KEGG DISEASE;H00083

Disease

Pre-Eclampsia;FunDO

Disease

tuberculosis;GAD

Disease

diabetes, type 2;GAD

Disease

Bronchiectasis;FunDO

Disease

Bronchiolitis obliterans;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

rheumatoid arthritis;GAD

Disease

allergies;GAD

Disease

Brucellosis;FunDO

Disease

lung allograft fibrosis;GAD

Disease

Graft-versus-host disease;KEGG DISEASE;H00084

Disease

Virus disease;FunDO

Disease

Immune system diseases;KEGG DISEASE

Disease

Celiac disease;FunDO

Disease

Anorexia nervosa;FunDO

Disease

bronchiolitis obliterans syndrome;GAD

Disease

hepatitis B, intrauterine;GAD

Disease

SPT;GAD

Disease

purpura;GAD

Disease

Langerhans cell histiocytosis;GAD

Disease

preterm delivery;GAD

Disease

Periodontitis;FunDO

Disease

Hepatitis C;FunDO

Disease

Breast cancer;FunDO

Disease

angiomyolipomas, renal;GAD

Disease

Parkinson disease;FunDO

Disease

Embryoma;FunDO

Disease

Fanconi's anemia;FunDO

Disease

parvovirus;GAD

Disease

cervical cancer;GAD

Disease

hepatitis E;GAD

Disease

nephropathy;GAD

Disease

Liver disease;FunDO

Disease

Asthma;GAD

Disease

Heart Failure;GAD

Disease

Pancreas cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

coeliac disease;GAD

Disease

Intraocular melanoma;FunDO

Disease

esophageal cancer;GAD

Disease

Diabetes mellitus;FunDO

Disease

CHEMDEPENDENCY;GAD

Disease

Lichen planus;FunDO

Disease

Celiac Disease;GAD

Disease

Childhood atopic asthma;GAD

Disease

Multiple sclerosis;FunDO

Disease

Familial Mediterranean fever;FunDO

Disease

cirrhosis hepatitis C, chronic;GAD

Disease

giant cell arteritis;GAD

Disease

Endometriosis;FunDO

Disease

ulcerative colitis;GAD

Disease

Dermatitis;FunDO

Disease

Pelvic inflammatory disease;FunDO

Disease

lung function;GAD

Disease

acute and chronic kidney transplant outcome;GAD

Disease

Angiomyolipoma;FunDO

Disease

renal transplant;GAD

External Links

Links to cell senescence gene database

3458

Links to epithelial mesenchymal transition gene database

3458

Links to ovarian cancer gene database

3458

Links to endometrial cancer gene database

3458

Links to iHOP

3458

Sequence Information

Nucleotide Sequence

>3458 : length: 1240
CACATTGTTCTGATCATCTGAAGATCAGCTATTAGAAGAGAAAGATCAGTTAAGTCCTTT
GGACCTGATCAGCTTGATACAAGAACTACTGATTTCAACTTCTTTGGCTTAATTCTCTCG
GAAACGATGAAATATACAAGTTATATCTTGGCTTTTCAGCTCTGCATCGTTTTGGGTTCT
CTTGGCTGTTACTGCCAGGACCCATATGTAAAAGAAGCAGAAAACCTTAAGAAATATTTT
AATGCAGGTCATTCAGATGTAGCGGATAATGGAACTCTTTTCTTAGGCATTTTGAAGAAT
TGGAAAGAGGAGAGTGACAGAAAAATAATGCAGAGCCAAATTGTCTCCTTTTACTTCAAA
CTTTTTAAAAACTTTAAAGATGACCAGAGCATCCAAAAGAGTGTGGAGACCATCAAGGAA
GACATGAATGTCAAGTTTTTCAATAGCAACAAAAAGAAACGAGATGACTTCGAAAAGCTG
ACTAATTATTCGGTAACTGACTTGAATGTCCAACGCAAAGCAATACATGAACTCATCCAA
GTGATGGCTGAACTGTCGCCAGCAGCTAAAACAGGGAAGCGAAAAAGGAGTCAGATGCTG
TTTCGAGGTCGAAGAGCATCCCAGTAATGGTTGTCCTGCCTGCAATATTTGAATTTTAAA
TCTAAATCTATTTATTAATATTTAACATTATTTATATGGGGAATATATTTTTAGACTCAT
CAATCAAATAAGTATTTATAATAGCAACTTTTGTGTAATGAAAATGAATATCTATTAATA
TATGTATTATTTATAATTCCTATATCCTGTGACTGTCTCACTTAATCCTTTGTTTTCTGA
CTAATTAGGCAAGGCTATGTGATTACAAGGCTTTATCTCAGGGGCCAACTAGGCAGCCAA
CCTAAGCAAGATCCCATGGGTTGTGTGTTTATTTCACTTGATGATACAATGAACACTTAT
AAGTGAAGTGATACTATCCAGTTACTGCCGGTTTGAAAATATGCCTGCAATCTGAGCCAG
TGCTTTAATGGCATGTCAGACAGAACTTGAATGTGTCAGGTGACCCTGATGAAAACATAG
CATCTCAGGAGATTTCATGCCTGGTGCTTCCAAATATTGTTGACAACTGTGACTGTACCC
AAATGGAAAGTAACTCATTTGTTAAAATTATCAATATCTAATATATATGAATAAAGTGTA
AGTTCACAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>3458 : length: 166
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ