ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3417

Name

IDH1

Synonym

HEL-216|HEL-S-26|IDCD|IDH|IDP|IDPC|PICD;isocitrate dehydrogenase 1 (NADP+), soluble;IDH1;isocitrate dehydrogenase 1 (NADP+), soluble

Definition

NADP(+)-specific ICDH|NADP-dependent isocitrate dehydrogenase, cytosolic|NADP-dependent isocitrate dehydrogenase, peroxisomal|epididymis luminal protein 216|epididymis secretory protein Li 26|isocitrate dehydrogenase [NADP] cytoplasmic|oxalosuccinate deca

Position

2q33.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Citrate cycle (TCA cycle);KEGG PATHWAY;hsa00020

Pathway

respiration (anaerobic);BioCyc;ANARESP1-PWY

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Glutathione metabolism;KEGG PATHWAY;hsa00480

Pathway

Metabolism of lipids and lipoproteins;Reactome;REACT:22258

Pathway

Peroxisome;KEGG PATHWAY;hsa04146

Pathway

NADPH regeneration;PID Reactome;500823

Disease

Cancer;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

3417

Links to epithelial mesenchymal transition gene database

3417

Links to ovarian cancer gene database

3417

Links to endometrial cancer gene database

3417

Links to iHOP

3417

Sequence Information

Nucleotide Sequence

>3417 : length: 2470
CGTGGAGACCTGGAAGGAGGTACCGATCCAGCCTTGATTGCAGCCCTCTTGCACAACGGC
CATAAGGACGGGTGCAGGCCAAGAGCAAGGACATGCAAACCCCAAGACCTGCTAACGGGC
GGCGAAGCGGGGGCACGCCCTCGCACACGCAGAGATAAATTGTGCTCCCATGACCTTTAT
TTGGAAAGTGCCTGCGGGCCTAAAATTGGCCTTTGTCCCACCGAGTACACTCAGCACTGT
ACTTTAAACCGGATAAACTGGGCTGTCTGGCAGGCGATAAACTACATTCAGTTGAGTCTG
CAAGACTGGGAGGAACTGGGGTGATAAGAAATCTATTCACTGTCAAGGTTTATTGAAGTC
AAAATGTCCAAAAAAATCAGTGGCGGTTCTGTGGTAGAGATGCAAGGAGATGAAATGACA
CGAATCATTTGGGAATTGATTAAAGAGAAACTCATTTTTCCCTACGTGGAATTGGATCTA
CATAGCTATGATTTAGGCATAGAGAATCGTGATGCCACCAACGACCAAGTCACCAAGGAT
GCTGCAGAAGCTATAAAGAAGCATAATGTTGGCGTCAAATGTGCCACTATCACTCCTGAT
GAGAAGAGGGTTGAGGAGTTCAAGTTGAAACAAATGTGGAAATCACCAAATGGCACCATA
CGAAATATTCTGGGTGGCACGGTCTTCAGAGAAGCCATTATCTGCAAAAATATCCCCCGG
CTTGTGAGTGGATGGGTAAAACCTATCATCATAGGTCGTCATGCTTATGGGGATCAATAC
AGAGCAACTGATTTTGTTGTTCCTGGGCCTGGAAAAGTAGAGATAACCTACACACCAAGT
GACGGAACCCAAAAGGTGACATACCTGGTACATAACTTTGAAGAAGGTGGTGGTGTTGCC
ATGGGGATGTATAATCAAGATAAGTCAATTGAAGATTTTGCACACAGTTCCTTCCAAATG
GCTCTGTCTAAGGGTTGGCCTTTGTATCTGAGCACCAAAAACACTATTCTGAAGAAATAT
GATGGGCGTTTTAAAGACATCTTTCAGGAGATATATGACAAGCAGTACAAGTCCCAGTTT
GAAGCTCAAAAGATCTGGTATGAGCATAGGCTCATCGACGACATGGTGGCCCAAGCTATG
AAATCAGAGGGAGGCTTCATCTGGGCCTGTAAAAACTATGATGGTGACGTGCAGTCGGAC
TCTGTGGCCCAAGGGTATGGCTCTCTCGGCATGATGACCAGCGTGCTGGTTTGTCCAGAT
GGCAAGACAGTAGAAGCAGAGGCTGCCCACGGGACTGTAACCCGTCACTACCGCATGTAC
CAGAAAGGACAGGAGACGTCCACCAATCCCATTGCTTCCATTTTTGCCTGGACCAGAGGG
TTAGCCCACAGAGCAAAGCTTGATAACAATAAAGAGCTTGCCTTCTTTGCAAATGCTTTG
GAAGAAGTCTCTATTGAGACAATTGAGGCTGGCTTCATGACCAAGGACTTGGCTGCTTGC
ATTAAAGGTTTACCCAATGTGCAACGTTCTGACTACTTGAATACATTTGAGTTCATGGAT
AAACTTGGAGAAAACTTGAAGATCAAACTAGCTCAGGCCAAACTTTAAGTTCATACCTGA
GCTAAGAAGGATAATTGTCTTTTGGTAACTAGGTCTACAGGTTTACATTTTTCTGTGTTA
CACTCAAGGATAAAGGCAAAATCAATTTTGTAATTTGTTTAGAAGCCAGAGTTTATCTTT
TCTATAAGTTTACAGCCTTTTTCTTATATATACAGTTATTGCCACCTTTGTGAACATGGC
AAGGGACTTTTTTACAATTTTTATTTTATTTTCTAGTACCAGCCTAGGAATTCGGTTAGT
ACTCATTTGTATTCACTGTCACTTTTTCTCATGTTCTAATTATAAATGACCAAAATCAAG
ATTGCTCAAAAGGGTAAATGATAGCCACAGTATTGCTCCCTAAAATATGCATAAAGTAGA
AATTCACTGCCTTCCCCTCCTGTCCATGACCTTGGGCACAGGGAAGTTCTGGTGTCATAG
ATATCCCGTTTTGTGAGGTAGAGCTGTGCATTAAACTTGCACATGACTGGAACGAAGTAT
GAGTGCAACTCAAATGTGTTGAAGATACTGCAGTCATTTTTGTAAAGACCTTGCTGAATG
TTTCCAATAGACTAAATACTGTTTAGGCCGCAGGAGAGTTTGGAATCCGGAATAAATACT
ACCTGGAGGTTTGTCCTCTCCATTTTTCTCTTTCTCCTCCTGGCCTGGCCTGAATATTAT
ACTACTCTAAATAGCATATTTCATCCAAGTGCAATAATGTAAGCTGAATCTTTTTTGGAC
TTCTGCTGGCCTGTTTTATTTCTTTTATATAAATGTGATTTCTCAGAAATTGATATTAAA
CACTATCTTATCTTCTCCTGAACTGTTGATTTTAATTAAAATTAAGTGCTAATTACCATT
AAAAAAAAAA

Protein Sequence

>3417 : length: 414
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL