ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3398

Name

ID2

Synonym

GIG8|ID2A|ID2H|bHLHb26;inhibitor of DNA binding 2, dominant negative helix-loop-helix protein;ID2;inhibitor of DNA binding 2, dominant negative helix-loop-helix protein

Definition

DNA-binding protein inhibitor ID-2|DNA-binding protein inhibitor ID2|cell growth-inhibiting gene 8|class B basic helix-loop-helix protein 26|helix-loop-helix protein ID2|inhibitor of differentiation 2

Position

2p25

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Rett syndrome;FunDO

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

3398

Links to epithelial mesenchymal transition gene database

3398

Links to ovarian cancer gene database

3398

Links to endometrial cancer gene database

3398

Links to iHOP

3398

Sequence Information

Nucleotide Sequence

>3398 : length: 1402
GGGGACGAAGGGAAGCTCCAGCGTGTGGCCCCGGCGAGTGCGGATAAAAGCCGCCCCGCC
GGGCTCGGGCTTCATTCTGAGCCGAGCCCGGTGCCAAGCGCAGCTAGCTCAGCAGGCGGC
AGCGGCGGCCTGAGCTTCAGGGCAGCCAGCTCCCTCCCGGTCTCGCCTTCCCTCGCGGTC
AGCATGAAAGCCTTCAGTCCCGTGAGGTCCGTTAGGAAAAACAGCCTGTCGGACCACAGC
CTGGGCATCTCCCGGAGCAAAACCCCTGTGGACGACCCGATGAGCCTGCTATACAACATG
AACGACTGCTACTCCAAGCTCAAGGAGCTGGTGCCCAGCATCCCCCAGAACAAGAAGGTG
AGCAAGATGGAAATCCTGCAGCACGTCATCGACTACATCTTGGACCTGCAGATCGCCCTG
GACTCGCATCCCACTATTGTCAGCCTGCATCACCAGAGACCCGGGCAGAACCAGGCGTCC
AGGACGCCGCTGACCACCCTCAACACGGATATCAGCATCCTGTCCTTGCAGGCTTCTGAA
TTCCCTTCTGAGTTAATGTCAAATGACAGCAAAGCACTGTGTGGCTGAATAAGCGGTGTT
CATGATTTCTTTTATTCTTTGCACAACAACAACAACAACAAATTCACGGAATCTTTTAAG
TGCTGAACTTATTTTTCAACCATTTCACAAGGAGGACAAGTTGAATGGACCTTTTTAAAA
AGAAAAAAAAAATGGAAGGAAAACTAAGAATGATCATCTTCCCAGGGTGTTCTCTTACTT
GGACTGTGATATTCGTTATTTATGAAAAAGACTTTTAAATGCCCTTTCTGCAGTTGGAAG
GTTTTCTTTATATACTATTCCCACCATGGGGAGCGAAAACGTTAAAATCACAAGGAATTG
CCCAATCTAAGCAGACTTTGCCTTTTTTCAAAGGTGGAGCGTGAATACCAGAAGGATCCA
GTATTCAGTCACTTAAATGAAGTCTTTTGGTCAGAAATTACCTTTTTGACACAAGCCTAC
TGAATGCTGTGTATATATTTATATATAAATATATCTATTTGAGTGAAACCTTGTGAACTC
TTTAATTAGAGTTTTCTTGTATAGTGGCAGAGATGTCTATTTCTGCATTCAAAAGTGTAA
TGATGTACTTATTCATGCTAAACTTTTTATAAAAGTTTAGTTGTAAACTTAACCCTTTTA
TACAAAATAAATCAAGTGTGTTTATTGAATGGTGATTGCCTGCTTTATTTCAGAGGACCA
GTGCTTTGATTTTTATTATGCTATGTTATAACTGAACCCAAATAAATACAAGTTCAAATT
TATGTAGACTGTATAAGATTATAATAAAACATGTCTGAAGTCAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>3398 : length: 134
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG