ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3397

Name

ID1

Synonym

ID|bHLHb24;inhibitor of DNA binding 1, dominant negative helix-loop-helix protein;ID1;inhibitor of DNA binding 1, dominant negative helix-loop-helix protein

Definition

DNA-binding protein inhibitor ID-1|class B basic helix-loop-helix protein 24|dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein)|inhibitor of differentiation 1

Position

20q11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

ALK1 signaling events;PID Curated;200126

Disease

Rett syndrome;FunDO

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

3397

Links to epithelial mesenchymal transition gene database

3397

Links to ovarian cancer gene database

3397

Links to endometrial cancer gene database

3397

Links to iHOP

3397

Sequence Information

Nucleotide Sequence

>3397 : length: 1239
ACTCTCATTCCACGTTCTTAACTGTTCCATTTTCCGTATCTGCTTCGGGCTTCCACCTCA
TTTTTTTCGCTTTGCCCATTCTGTTTCAGCCAGTCGCCAAGAATCATGAAAGTCGCCAGT
GGCAGCACCGCCACCGCCGCCGCGGGCCCCAGCTGCGCGCTGAAGGCCGGCAAGACAGCG
AGCGGTGCGGGCGAGGTGGTGCGCTGTCTGTCTGAGCAGAGCGTGGCCATCTCGCGCTGC
GCCGGGGGCGCCGGGGCGCGCCTGCCTGCCCTGCTGGACGAGCAGCAGGTAAACGTGCTG
CTCTACGACATGAACGGCTGTTACTCACGCCTCAAGGAGCTGGTGCCCACCCTGCCCCAG
AACCGCAAGGTGAGCAAGGTGGAGATTCTCCAGCACGTCATCGACTACATCAGGGACCTT
CAGTTGGAGCTGAACTCGGAATCCGAAGTTGGAACCCCCGGGGGCCGAGGGCTGCCGGTC
CGGGCTCCGCTCAGCACCCTCAACGGCGAGATCAGCGCCCTGACGGCCGAGGTGAGATCC
AGATCCGACCACTAGATCATCCTTATACCGACGGGGAAACGGAGGCCAGAGAGGGCGTGG
GCGCTTGCACCACTTCCGTCCCATCCTTGCGGGTACCTGGCTATGCGGGGGTGCCTAAGG
AGCCTGGAAAAAGCGCTCCCCCGTCGTGCTTCCTGGGGAAGGGGGCGTTCGCTGCGCTCG
GAGCGGCGTCCCTTCCAACCCGCCGGTCTCATTTCTTCTCGTTTTCACAGGCGGCATGCG
TTCCTGCGGACGATCGCATCTTGTGTCGCTGAAGCGCCTCCCCCAGGGACCGGCGGACCC
CAGCCATCCAGGGGGCAAGAGGAATTACGTGCTCTGTGGGTCTCCCCCAACGCGCCTCGC
CGGATCTGAGGGAGAACAAGACCGATCGGCGGCCACTGCGCCCTTAACTGCATCCAGCCT
GGGGCTGAGGCTGAGGCACTGGCGAGGAGAGGGCGCTCCTCTCTGCACACCTACTAGTCA
CCAGAGACTTTAGGGGGTGGGATTCCACTCGTGTGTTTCTATTTTTTGAAAAGCAGACAT
TTTAAAAAATGGTCACGTTTGGTGCTTCTCAGATTTCTGAGGAAATTGCTTTGTATTGTA
TATTACAATGATCACCGACTGAAAATATTGTTTTACAATAGTTCTGTGGGGCTGTTTTTT
TGTTATTAAACAAATAATTTAGATGGTGGTAAAAAAAAA

Protein Sequence

>3397 : length: 155
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR