ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

332

Name

BIRC5

Synonym

API4|EPR-1;baculoviral IAP repeat containing 5;BIRC5;baculoviral IAP repeat containing 5

Definition

apoptosis inhibitor 4|apoptosis inhibitor survivin|baculoviral IAP repeat-containing protein 5|survivin variant 3 alpha

Position

17q25

Gene Type

protein-coding

Pathways and Diseases

Pathway

b cell survival pathway;PID BioCarta;100228

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Aurora B signaling;PID Curated;200010

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Aurora A signaling;PID Curated;200166

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

DNA Replication;Reactome;REACT:383

Disease

Eosinophilia;FunDO

Disease

Epstein-Barr virus infection;FunDO

Disease

Testicular dysfunction;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Adenovirus infection;FunDO

Disease

Corneal disease;FunDO

Disease

Congenital abnormality;FunDO

Disease

Cancer;FunDO

Disease

Infertility;FunDO

Disease

Parasitic disease;FunDO

Disease

Endometriosis;FunDO

Disease

HIV infection;FunDO

Disease

Leukoencephalopathy;FunDO

Disease

Arthritis;FunDO

External Links

Links to cell senescence gene database

332

Links to epithelial mesenchymal transition gene database

332

Links to ovarian cancer gene database

332

Links to endometrial cancer gene database

332

Links to iHOP

332

Sequence Information

Nucleotide Sequence

>332 : length: 2724
CCCAGAAGGCCGCGGGGGGTGGACCGCCTAAGAGGGCGTGCGCTCCCGACATGCCCCGCG
GCGCGCCATTAACCGCCAGATTTGAATCGCGGGACCCGTTGGCAGAGGTGGCGGCGGCGG
CATGGGTGCCCCGACGTTGCCCCCTGCCTGGCAGCCCTTTCTCAAGGACCACCGCATCTC
TACATTCAAGAACTGGCCCTTCTTGGAGGGCTGCGCCTGCACCCCGGAGCGGATGGCCGA
GGCTGGCTTCATCCACTGCCCCACTGAGAACGAGCCAGACTTGGCCCAGTGTTTCTTCTG
CTTCAAGGAGCTGGAAGGCTGGGAGCCAGATGACGACCCCATTGGGCCGGGCACGGTGGC
TTACGCCTGTAATACCAGCACTTTGGGAGGCCGAGGCGGGCGGATCACGAGAGAGGAACA
TAAAAAGCATTCGTCCGGTTGCGCTTTCCTTTCTGTCAAGAAGCAGTTTGAAGAATTAAC
CCTTGGTGAATTTTTGAAACTGGACAGAGAAAGAGCCAAGAACAAAATTGCAAAGGAAAC
CAACAATAAGAAGAAAGAATTTGAGGAAACTGCGGAGAAAGTGCGCCGTGCCATCGAGCA
GCTGGCTGCCATGGATTGAGGCCTCTGGCCGGAGCTGCCTGGTCCCAGAGTGGCTGCACC
ACTTCCAGGGTTTATTCCCTGGTGCCACCAGCCTTCCTGTGGGCCCCTTAGCAATGTCTT
AGGAAAGGAGATCAACATTTTCAAATTAGATGTTTCAACTGTGCTCTTGTTTTGTCTTGA
AAGTGGCACCAGAGGTGCTTCTGCCTGTGCAGCGGGTGCTGCTGGTAACAGTGGCTGCTT
CTCTCTCTCTCTCTCTTTTTTGGGGGCTCATTTTTGCTGTTTTGATTCCCGGGCTTACCA
GGTGAGAAGTGAGGGAGGAAGAAGGCAGTGTCCCTTTTGCTAGAGCTGACAGCTTTGTTC
GCGTGGGCAGAGCCTTCCACAGTGAATGTGTCTGGACCTCATGTTGTTGAGGCTGTCACA
GTCCTGAGTGTGGACTTGGCAGGTGCCTGTTGAATCTGAGCTGCAGGTTCCTTATCTGTC
ACACCTGTGCCTCCTCAGAGGACAGTTTTTTTGTTGTTGTGTTTTTTTGTTTTTTTTTTT
TTGGTAGATGCATGACTTGTGTGTGATGAGAGAATGGAGACAGAGTCCCTGGCTCCTCTA
CTGTTTAACAACATGGCTTTCTTATTTTGTTTGAATTGTTAATTCACAGAATAGCACAAA
CTACAATTAAAACTAAGCACAAAGCCATTCTAAGTCATTGGGGAAACGGGGTGAACTTCA
GGTGGATGAGGAGACAGAATAGAGTGATAGGAAGCGTCTGGCAGATACTCCTTTTGCCAC
TGCTGTGTGATTAGACAGGCCCAGTGAGCCGCGGGGCACATGCTGGCCGCTCCTCCCTCA
GAAAAAGGCAGTGGCCTAAATCCTTTTTAAATGACTTGGCTCGATGCTGTGGGGGACTGG
CTGGGCTGCTGCAGGCCGTGTGTCTGTCAGCCCAACCTTCACATCTGTCACGTTCTCCAC
ACGGGGGAGAGACGCAGTCCGCCCAGGTCCCCGCTTTCTTTGGAGGCAGCAGCTCCCGCA
GGGCTGAAGTCTGGCGTAAGATGATGGATTTGATTCGCCCTCCTCCCTGTCATAGAGCTG
CAGGGTGGATTGTTACAGCTTCGCTGGAAACCTCTGGAGGTCATCTCGGCTGTTCCTGAG
AAATAAAAAGCCTGTCATTTCAAACACTGCTGTGGACCCTACTGGGTTTTTAAAATATTG
TCAGTTTTTCATCGTCGTCCCTAGCCTGCCAACAGCCATCTGCCCAGACAGCCGCAGTGA
GGATGAGCGTCCTGGCAGAGACGCAGTTGTCTCTGGGCGCTTGCCAGAGCCACGAACCCC
AGACCTGTTTGTATCATCCGGGCTCCTTCCGGGCAGAAACAACTGAAAATGCACTTCAGA
CCCACTTATTTCTGCCACATCTGAGTCGGCCTGAGATAGACTTTTCCCTCTAAACTGGGA
GAATATCACAGTGGTTTTTGTTAGCAGAAAATGCACTCCAGCCTCTGTACTCATCTAAGC
TGCTTATTTTTGATATTTGTGTCAGTCTGTAAATGGATACTTCACTTTAATAACTGTTGC
TTAGTAATTGGCTTTGTAGAGAAGCTGGAAAAAAATGGTTTTGTCTTCAACTCCTTTGCA
TGCCAGGCGGTGATGTGGATCTCGGCTTCTGTGAGCCTGTGCTGTGGGCAGGGCTGAGCT
GGAGCCGCCCCTCTCAGCCCGCCTGCCACGGCCTTTCCTTAAAGGCCATCCTTAAAACCA
GACCCTCATGGCTACCAGCACCTGAAAGCTTCCTCGACATCTGTTAATAAAGCCGTAGGC
CCTTGTCTAAGTGCAACCGCCTAGACTTTCTTTCAGATACATGTCCACATGTCCATTTTT
CAGGTTCTCTAAGTTGGAGTGGAGTCTGGGAAGGGTTGTGAATGAGGCTTCTGGGCTATG
GGTGAGGTTCCAATGGCAGGTTAGAGCCCCTCGGGCCAACTGCCATCCTGGAAAGTAGAG
ACAGCAGTGCCCGCTGCCCAGAAGAGACCAGCAAGCCAAACTGGAGCCCCCATTGCAGGC
TGTCGCCATGTGGAAAGAGTAACTCACAATTGCCAATAAAGTCTCATGTGGTTTTATCTA
AAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>332 : length: 165
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIGPGTVAYACNTSTLGGRGGRITREEHKKHSSGCAFLSVKKQFEELT
LGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD