ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3315

Name

HSPB1

Synonym

CMT2F|HEL-S-102|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27;heat shock 27kDa protein 1;HSPB1;heat shock 27kDa protein 1

Definition

28 kDa heat shock protein|HSP 27|epididymis secretory protein Li 102|estrogen-regulated 24 kDa protein|heat shock 27 kDa protein|heat shock 27kD protein 1|heat shock protein beta-1|stress-responsive protein 27

Position

7q11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

downregulated of mta-3 in er-negative breast tumors;PID BioCarta;100102

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

p38 signaling mediated by MAPKAP kinases;PID Curated;200135

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

stress induction of hsp regulation;PID BioCarta;100142

Pathway

p38 mapk signaling pathway;PID BioCarta;100085

Pathway

Signaling mediated by p38-alpha and p38-beta;PID Curated;200154

Disease

Renal Cell cancer;FunDO

Disease

Charcot-Marie-Tooth disease;FunDO

Disease

Squamous cell cancer;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Dermatitis;FunDO

Disease

Prostate cancer;FunDO

Disease

Neuropathy, distal hereditary motor, type IIB;OMIM

Disease

Liver tumor;FunDO

Disease

Multiple myeloma;FunDO

Disease

Liver disease;FunDO

Disease

Barrett's esophagus;FunDO

Disease

Aortic aneurysm;FunDO

Disease

Spinal cord disease;FunDO

Disease

Ewings sarcoma;FunDO

Disease

Dental plaque;FunDO

Disease

Charcot-Marie-Tooth disease, axonal, type 2F;OMIM

Disease

Asthma;FunDO

Disease

Liver cancer;FunDO

Disease

HIV infection;FunDO

Disease

Aortic valve disease;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to cell senescence gene database

3315

Links to epithelial mesenchymal transition gene database

3315

Links to ovarian cancer gene database

3315

Links to endometrial cancer gene database

3315

Links to iHOP

3315

Sequence Information

Nucleotide Sequence

>3315 : length: 914
GCATGGGGAGGGGCGGCCCTCAAACGGGTCATTGCCATTAATAGAGACCTCAAACACCGC
CTGCTAAAAATACCCGACTGGAGGAGCATAAAAGCGCAGCCGAGCCCAGCGCCCCGCACT
TTTCTGAGCAGACGTCCAGAGCAGAGTCAGCCAGCATGACCGAGCGCCGCGTCCCCTTCT
CGCTCCTGCGGGGCCCCAGCTGGGACCCCTTCCGCGACTGGTACCCGCATAGCCGCCTCT
TCGACCAGGCCTTCGGGCTGCCCCGGCTGCCGGAGGAGTGGTCGCAGTGGTTAGGCGGCA
GCAGCTGGCCAGGCTACGTGCGCCCCCTGCCCCCCGCCGCCATCGAGAGCCCCGCAGTGG
CCGCGCCCGCCTACAGCCGCGCGCTCAGCCGGCAACTCAGCAGCGGGGTCTCGGAGATCC
GGCACACTGCGGACCGCTGGCGCGTGTCCCTGGATGTCAACCACTTCGCCCCGGACGAGC
TGACGGTCAAGACCAAGGATGGCGTGGTGGAGATCACCGGCAAGCACGAGGAGCGGCAGG
ACGAGCATGGCTACATCTCCCGGTGCTTCACGCGGAAATACACGCTGCCCCCCGGTGTGG
ACCCCACCCAAGTTTCCTCCTCCCTGTCCCCTGAGGGCACACTGACCGTGGAGGCCCCCA
TGCCCAAGCTAGCCACGCAGTCCAACGAGATCACCATCCCAGTCACCTTCGAGTCGCGGG
CCCAGCTTGGGGGCCCAGAAGCTGCAAAATCCGATGAGACTGCCGCCAAGTAAAGCCTTA
GCCCGGATGCCCACCCCTGCTGCCGCCACTGGCTGTGCCTCCCCCGCCACCTGTGTGTTC
TTTTGATACATTTATCTTCTGTTTTTCTCAAATAAAGTTCAAAGCAACCACCTGTCAAAA
AAAAAAAAAAAAAA

Protein Sequence

>3315 : length: 205
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
IPVTFESRAQLGGPEAAKSDETAAK