ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3309

Name

HSPA5

Synonym

BIP|GRP78|HEL-S-89n|MIF2;heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa);HSPA5;heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)

Definition

78 kDa glucose-regulated protein|endoplasmic reticulum lumenal Ca(2+)-binding protein grp78|epididymis secretory sperm binding protein Li 89n|immunoglobulin heavy chain-binding protein

Position

9q33.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Activation of Chaperones by ATF6-alpha;PID Reactome;500130

Pathway

Antigen processing and presentation;KEGG PATHWAY;hsa04612

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Protein export;KEGG PATHWAY;hsa03060

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

Hemostasis;Reactome;REACT:604

Pathway

PERK regulated gene expression;PID Reactome;500132

Pathway

Activation of Chaperones by IRE1alpha;PID Reactome;500131

Pathway

prion pathway;PID BioCarta;100062

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Unfolded Protein Response;PID Reactome;500129

Pathway

Platelet degranulation;PID Reactome;500959

Pathway

Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141

Pathway

Prion diseases;KEGG PATHWAY;hsa05020

Disease

HIV infection;FunDO

Disease

Cancer;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Bipolar disorder;FunDO

External Links

Links to cell senescence gene database

3309

Links to epithelial mesenchymal transition gene database

3309

Links to ovarian cancer gene database

3309

Links to endometrial cancer gene database

3309

Links to iHOP

3309

Sequence Information

Nucleotide Sequence

>3309 : length: 3973
GGGCTGGGGGAGGGTATATAAGCCGAGTAGGCGACGGTGAGGTCGACGCCGGCCAAGACA
GCACAGACAGATTGACCTATTGGGGTGTTTCGCGAGTGTGAGAGGGAAGCGCCGCGGCCT
GTATTTCTAGACCTGCCCTTCGCCTGGTTCGTGGCGCCTTGTGACCCCGGGCCCCTGCCG
CCTGCAAGTCGGAAATTGCGCTGTGCTCCTGTGCTACGGCCTGTGGCTGGACTGCCTGCT
GCTGCCCAACTGGCTGGCAAGATGAAGCTCTCCCTGGTGGCCGCGATGCTGCTGCTGCTC
AGCGCGGCGCGGGCCGAGGAGGAGGACAAGAAGGAGGACGTGGGCACGGTGGTCGGCATC
GACCTGGGGACCACCTACTCCTGCGTCGGCGTGTTCAAGAACGGCCGCGTGGAGATCATC
GCCAACGATCAGGGCAACCGCATCACGCCGTCCTATGTCGCCTTCACTCCTGAAGGGGAA
CGTCTGATTGGCGATGCCGCCAAGAACCAGCTCACCTCCAACCCCGAGAACACGGTCTTT
GACGCCAAGCGGCTCATCGGCCGCACGTGGAATGACCCGTCTGTGCAGCAGGACATCAAG
TTCTTGCCGTTCAAGGTGGTTGAAAAGAAAACTAAACCATACATTCAAGTTGATATTGGA
GGTGGGCAAACAAAGACATTTGCTCCTGAAGAAATTTCTGCCATGGTTCTCACTAAAATG
AAAGAAACCGCTGAGGCTTATTTGGGAAAGAAGGTTACCCATGCAGTTGTTACTGTACCA
GCCTATTTTAATGATGCCCAACGCCAAGCAACCAAAGACGCTGGAACTATTGCTGGCCTA
AATGTTATGAGGATCATCAACGAGCCTACGGCAGCTGCTATTGCTTATGGCCTGGATAAG
AGGGAGGGGGAGAAGAACATCCTGGTGTTTGACCTGGGTGGCGGAACCTTCGATGTGTCT
CTTCTCACCATTGACAATGGTGTCTTCGAAGTTGTGGCCACTAATGGAGATACTCATCTG
GGTGGAGAAGACTTTGACCAGCGTGTCATGGAACACTTCATCAAACTGTACAAAAAGAAG
ACGGGCAAAGATGTCAGGAAAGACAATAGAGCTGTGCAGAAACTCCGGCGCGAGGTAGAA
AAGGCCAAACGGGCCCTGTCTTCTCAGCATCAAGCAAGAATTGAAATTGAGTCCTTCTAT
GAAGGAGAAGACTTTTCTGAGACCCTGACTCGGGCCAAATTTGAAGAGCTCAACATGGAT
CTGTTCCGGTCTACTATGAAGCCCGTCCAGAAAGTGTTGGAAGATTCTGATTTGAAGAAG
TCTGATATTGATGAAATTGTTCTTGTTGGTGGCTCGACTCGAATTCCAAAGATTCAGCAA
CTGGTTAAAGAGTTCTTCAATGGCAAGGAACCATCCCGTGGCATAAACCCAGATGAAGCT
GTAGCGTATGGTGCTGCTGTCCAGGCTGGTGTGCTCTCTGGTGATCAAGATACAGGTGAC
CTGGTACTGCTTGATGTATGTCCCCTTACACTTGGTATTGAAACTGTGGGAGGTGTCATG
ACCAAACTGATTCCAAGGAACACAGTGGTGCCTACCAAGAAGTCTCAGATCTTTTCTACA
GCTTCTGATAATCAACCAACTGTTACAATCAAGGTCTATGAAGGTGAAAGACCCCTGACA
AAAGACAATCATCTTCTGGGTACATTTGATCTGACTGGAATTCCTCCTGCTCCTCGTGGG
GTCCCACAGATTGAAGTCACCTTTGAGATAGATGTGAATGGTATTCTTCGAGTGACAGCT
GAAGACAAGGGTACAGGGAACAAAAATAAGATCACAATCACCAATGACCAGAATCGCCTG
ACACCTGAAGAAATCGAAAGGATGGTTAATGATGCTGAGAAGTTTGCTGAGGAAGACAAA
AAGCTCAAGGAGCGCATTGATACTAGAAATGAGTTGGAAAGCTATGCCTATTCTCTAAAG
AATCAGATTGGAGATAAAGAAAAGCTGGGAGGTAAACTTTCCTCTGAAGATAAGGAGACC
ATGGAAAAAGCTGTAGAAGAAAAGATTGAATGGCTGGAAAGCCACCAAGATGCTGACATT
GAAGACTTCAAAGCTAAGAAGAAGGAACTGGAAGAAATTGTTCAACCAATTATCAGCAAA
CTCTATGGAAGTGCAGGCCCTCCCCCAACTGGTGAAGAGGATACAGCAGAAAAAGATGAG
TTGTAGACACTGATCTGCTAGTGCTGTAATATTGTAAATACTGGACTCAGGAACTTTTGT
TAGGAAAAAATTGAAAGAACTTAAGTCTCGAATGTAATTGGAATCTTCACCTCAGAGTGG
AGTTGAAACTGCTATAGCCTAAGCGGCTGTTTACTGCTTTTCATTAGCAGTTGCTCACAT
GTCTTTGGGTGGGGGGGAGAAGAAGAATTGGCCATCTTAAAAAGCGGGTAAAAAACCTGG
GTTAGGGTGTGTGTTCACCTTCAAAATGTTCTATTTAACAACTGGGTCATGTGCATCTGG
TGTAGGAAGTTTTTTCTACCATAAGTGACACCAATAAATGTTTGTTATTTACACTGGTCT
AATGTTTGTGAGAAGCTTCTAATTAGATCAATTACTTATTTTAGGAAATTTAAGACTAGA
TACTCGTGTGTGGGGTGAGGGGAGGGAGTATTTGGTATGTTGGGATAAGGAAACACTTCT
ATTTAATGCTTCCAGGGATTTTTTTTTTTTTTTTTAACCCTCCTGGGCCCAAGTGATCCT
TCCACCTCAGTCTCCCAGCTAATTGAGACCACAGGCTTGTTACCACCATGCTCGGCTTTT
GCATTAATCTAAGAAAAGGGGAGAGAAGTTAATCCACATCTTTACTCAGGCAAGGGGCAT
TTCACAGTGCCCAAGAGTGGGGTTTTCTTGAACATACTTGGTTTCCTATTTCCCCTTATC
TTTCTAAAACTGCCTTTCTGGTGGCTTTTTTTAAAATTATTACTAATGATGCTTTTATAG
CTGCTTGGATTCTCTGAGAAATGATGGGGAGTGAGTGATCACTGGTATTAACTTTATACA
CTTGGATTTCATTTGTAACTTTAGGATGTAAAGGTATATTGTGAACCCTAGCTGTGTCAG
AATCTCCATCCCTGAAATTTCTCATTAGTGGTACTGGGGTGGGATCTTGGATGGTGACAT
TGAAACTACACTAAATCCCCTCACTATGAATGGGTTGTTAAAGGCAATGGTTTGTGTCAA
AACTGGTTTAGGATTACTTAGATTGTGTTCCTGAAGAAAAGAGTCCAGGTAAATGGTATG
ATCAATAAAGGACAGGCTGGTGCTAACATAAAATCCAATATTGTAATCCTAGCACTTTGG
GAGGCCAAGGCGGGTGGATCACAAGGTCAAGAGATAGAGACCATCTTTGCCAACATGGTG
AAACTCCATCTCTACTGAAAATACAAAAATTAGCTGGGCGTGGTAGTGCAAGCTGAAGGC
TGAGGCAGGAGAATCACTCGAACCCGGGAGGCAGAGGTTGCAGTGAGCCGAGATCACACC
ACTGTACTCCAGCCCGGCACTCCAGCCTGGCGACAAGAGTGAGACTCCACCTCAAAAAAA
AAAAAAAGAATCCAATACTGCCCAAGGATAGGTATTTTATAGATGGGCAACTGGCTGAAA
GGTTAATTCTCTAGGGCTAGTAGAACTGGATCCCAACACCAAACTCTTAATTAGACCTAG
GCCTCAGCTGCACTGCCCGAAAAGCATTTGGGCAGACCCTGAGCAGAATACTGGTCTCAG
GCCAAGCCCAATACAGCCATTAAAGATGACCTACAGTGCTGTGTACCCTGGGGCAATAGG
GTTAAATGGTAGTTAGCAACTAGGGCTAGTCTTCCCTTACCTCAAAGGCTCTCACTACCG
TGGACCACCTAGTCTGTAACTCTTTCTGAGGAGCTGTTACTGAATATTAAAAAGATAGAC
TTCAACTATGAAA

Protein Sequence

>3309 : length: 654
MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVV
EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ
RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG
VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS
SQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV
LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG
TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER
MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEE
KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL