ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3308

Name

HSPA4

Synonym

APG-2|HEL-S-5a|HS24/P52|HSPH2|RY|hsp70|hsp70RY;heat shock 70kDa protein 4;HSPA4;heat shock 70kDa protein 4

Definition

epididymis secretory sperm binding protein Li 5a|heat shock 70 kDa protein 4|heat shock 70-related protein APG-2|heat shock 70kD protein 4|heat shock protein, 110 kDa|hsp70 RY

Position

5q31.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Antigen processing and presentation;KEGG PATHWAY;hsa04612

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Drug abuse;FunDO

Disease

Renal Cell cancer;FunDO

Disease

REPRODUCTION;GAD

Disease

Ischemia;FunDO

Disease

preterm delivery;GAD

Disease

Leukemia;FunDO

Disease

Liver cancer;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

3308

Links to epithelial mesenchymal transition gene database

3308

Links to ovarian cancer gene database

3308

Links to endometrial cancer gene database

3308

Links to iHOP

3308

Sequence Information

Nucleotide Sequence

>3308 : length: 3385
GCTCTGGTGCTGCGGCTCCGCTCTCGTCGCAACGAGATCTTTCGAGATCTTCTCCGCCCC
CGCTACCGGCGCCTCCTCTGCGGCCACTGAGCCGGAGCCGGCCTGAGCAGCGCTCTCGGT
TGCAGTACCCACTGGAAGGACTTAGGCGCTCGCGTGGACACCGCAAGCCCCTCAGTAGCC
TCGGCCCAAGAGGCCTGCTTTCCACTCGCTAGCCCCGCCGGGGGTCCGTGTCCTGTCTCG
GTGGCCGGACCCGGGCCCGAGCCCGAGCAGTAGCCGGCGCCATGTCGGTGGTGGGCATAG
ACCTGGGCTTCCAGAGCTGCTACGTCGCTGTGGCCCGCGCCGGCGGCATCGAGACTATCG
CTAATGAGTATAGCGACCGCTGCACGCCGGCTTGCATTTCTTTTGGTCCTAAGAATCGTT
CAATTGGAGCAGCAGCTAAAAGCCAGGTAATTTCTAATGCAAAGAACACAGTCCAAGGAT
TTAAAAGATTCCATGGCCGAGCATTCTCTGATCCATTTGTGGAGGCAGAAAAATCTAACC
TTGCATATGATATTGTGCAGTTGCCTACAGGATTAACAGGTATAAAGGTGACATATATGG
AGGAAGAGCGAAATTTTACCACTGAGCAAGTGACTGCCATGCTTTTGTCCAAACTGAAGG
AGACAGCCGAAAGTGTTCTTAAGAAGCCTGTAGTTGACTGTGTTGTTTCGGTTCCTTGTT
TCTATACTGATGCAGAAAGACGATCAGTGATGGATGCAACACAGATTGCTGGTCTTAATT
GCTTGCGATTAATGAATGAAACCACTGCAGTTGCTCTTGCATATGGAATCTATAAGCAGG
ATCTTCCTGCCTTAGAAGAGAAACCAAGAAATGTAGTTTTTGTAGACATGGGCCACTCTG
CTTATCAAGTTTCTGTATGTGCATTTAATAGAGGAAAACTGAAAGTTCTGGCCACTGCAT
TTGACACGACATTGGGAGGTAGAAAATTTGATGAAGTGTTAGTAAATCACTTCTGTGAAG
AATTTGGGAAGAAATACAAGCTAGACATTAAGTCCAAAATCCGTGCATTATTACGACTCT
CTCAGGAGTGTGAGAAACTCAAGAAATTGATGAGTGCAAATGCTTCAGATCTCCCTTTGA
GCATTGAATGTTTTATGAATGATGTTGATGTATCTGGAACTATGAATAGAGGCAAATTTC
TGGAGATGTGCAATGATCTCTTAGCTAGAGTGGAGCCACCACTTCGTAGTGTTTTGGAAC
AAACCAAGTTAAAGAAAGAAGATATTTATGCAGTGGAGATAGTTGGTGGTGCTACACGAA
TCCCTGCGGTAAAAGAGAAGATCAGCAAATTTTTCGGTAAAGAACTTAGTACAACATTAA
ATGCTGATGAAGCTGTCACTCGAGGCTGTGCATTGCAGTGTGCCATCTTATCGCCTGCTT
TCAAAGTCAGAGAATTTTCTATCACTGATGTAGTACCATATCCAATATCTCTGAGATGGA
ATTCTCCAGCTGAAGAAGGGTCAAGTGACTGTGAAGTCTTTTCCAAAAATCATGCTGCTC
CTTTCTCTAAAGTTCTTACATTTTATAGAAAGGAACCTTTCACTCTTGAGGCCTACTACA
GCTCTCCTCAGGATTTGCCCTATCCAGATCCTGCTATAGCTCAGTTTTCAGTTCAGAAAG
TCACTCCTCAGTCTGATGGCTCCAGTTCAAAAGTGAAAGTCAAAGTTCGAGTAAATGTCC
ATGGCATTTTCAGTGTGTCCAGTGCATCTTTAGTGGAGGTTCACAAGTCTGAGGAAAATG
AGGAGCCAATGGAAACAGATCAGAATGCAAAGGAGGAAGAGAAGATGCAAGTGGACCAGG
AGGAACCACATGTTGAAGAGCAACAGCAGCAGACACCAGCAGAAAATAAGGCAGAGTCTG
AAGAAATGGAGACCTCTCAAGCTGGATCCAAGGATAAAAAGATGGACCAACCACCCCAAG
CCAAGAAGGCAAAAGTGAAGACCAGTACTGTGGACCTGCCAATCGAGAATCAGCTATTAT
GGCAGATAGACAGAGAGATGCTCAACTTGTACATTGAAAATGAGGGTAAGATGATCATGC
AGGATAAACTGGAGAAGGAGCGGAATGATGCTAAGAACGCAGTGGAGGAATATGTGTATG
AAATGAGAGACAAGCTTAGTGGTGAATATGAGAAGTTTGTGAGTGAAGATGATCGTAACA
GTTTTACTTTGAAACTGGAAGATACTGAAAATTGGTTGTATGAGGATGGAGAAGACCAGC
CAAAGCAAGTTTATGTTGATAAGTTGGCTGAATTAAAAAATCTAGGTCAACCTATTAAGA
TACGTTTCCAGGAATCTGAAGAACGACCAAAATTATTTGAAGAACTAGGGAAACAGATCC
AACAGTATATGAAAATAATCAGCTCTTTCAAAAACAAGGAGGACCAGTATGATCATTTGG
ATGCTGCTGACATGACAAAGGTAGAAAAAAGCACAAATGAAGCAATGGAGTGGATGAATA
ACAAGCTAAATCTGCAGAACAAGCAGAGTTTGACCATGGATCCAGTTGTCAAGTCAAAAG
AGATTGAAGCTAAAATTAAGGAGCTGACAAGTACTTGTAGCCCTATAATTTCAAAGCCCA
AACCCAAAGTGGAACCTCCAAAAGAGGAACAAAAAAATGCAGAGCAGAATGGACCAGTGG
ATGGACAAGGAGACAACCCAGGCCCCCAGGCTGCTGAGCAGGGTACAGACACAGCTGTGC
CTTCGGATTCAGACAAGAAGCTTCCTGAAATGGACATTGATTGATTCCAACACTTGTTTC
TATTAAAACAGACTATTATAAAGCTTTAAGTTGTCAACTTTGTTCTAAATATCAACTAGC
GCAAGTGAATACTGAAGATTTCTTAGTCAGTTTTTAGGGGATTTTCGGGGAGGGGAAATA
GGTAATGTATGGAGCATTTTCACTTCTAAATAGTTAGATACAGAAATTAAGTGCATTGTA
TCTTTTTCATAATGGTACTATTTAGAAGCCCAGTTAGTCTTACTGAGCTTATGCTTCACT
CCTTTATGTTTAACCATGTGTCTACAAGAATAAGTTTGTTTTGGAAAGTTGAGCTATAGC
TACAGCTCTAGCTATCCAGCAGACTTTTCATTATGACTTACATGGCAGGAGCTCTAATTA
TGCTTTAAAAATCTGTTGTGGAGATTGCTTTAAATGCTCCCTGCCTGGTGTGGGGATGGG
GTCCCCCTCTTTGTGAGGGCTGGAGCATGGCACGGCATGGATTAACACGGCAGAGGAACA
AAGGTGTGCTCTGAGCTTCTTCATATTTCACCTTCACCCTCACCTGTGTTCTCTTCCCTC
TCTCCCAATAAAAGGGCTCCCATTA

Protein Sequence

>3308 : length: 840
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNA
KNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAM
LLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALA
YGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVL
VNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGT
MNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGK
ELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVF
SKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKV
KVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPA
ENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIEN
EGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLY
EDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKE
DQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCS
PIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID