ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3303

Name

HSPA1A

Synonym

HEL-S-103|HSP70-1|HSP70-1A|HSP70I|HSP72|HSPA1;heat shock 70kDa protein 1A;HSPA1A;heat shock 70kDa protein 1A

Definition

HSP70-1/HSP70-2|HSP70.1/HSP70.2|dnaK-type molecular chaperone HSP70-1|epididymis secretory protein Li 103|heat shock 70 kDa protein 1/2|heat shock 70 kDa protein 1A/1B|heat shock 70kD protein 1A|heat shock-induced protein

Position

6p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Prion diseases;KEGG PATHWAY;hsa05020

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Pathway

mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Spliceosome;KEGG PATHWAY;hsa03040

Pathway

Antigen processing and presentation;KEGG PATHWAY;hsa04612

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

Viral RNP Complexes in the Host Cell Nucleus;PID Reactome;500695

Pathway

Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

chaperones modulate interferon signaling pathway;PID BioCarta;100016

Pathway

Parkinson disease;PANTHER;P00049

Disease

Alzheimer's disease;GAD

Disease

high-altitude illness;GAD

Disease

Asthma;FunDO

Disease

Liver cancer;FunDO

Disease

AGING;GAD

Disease

longevity;GAD

Disease

Prostate cancer;FunDO

Disease

Dementia;GAD

Disease

kidney transplant;GAD

Disease

Respiratory failure;FunDO

Disease

INFECTION;GAD

Disease

Hearing Loss, Noise-Induced;GAD

Disease

Common cold;FunDO

Disease

sepsis;GAD

Disease

Diabetes mellitus;FunDO

Disease

preeclampsia;GAD

Disease

clozapine-induced agranulocytosis;GAD

Disease

Kidney failure;FunDO

Disease

NEUROLOGICAL;GAD

Disease

REPRODUCTION;GAD

Disease

Colon cancer;FunDO

Disease

RENAL;GAD

External Links

Links to cell senescence gene database

3303

Links to epithelial mesenchymal transition gene database

3303

Links to ovarian cancer gene database

3303

Links to endometrial cancer gene database

3303

Links to iHOP

3303

Sequence Information

Nucleotide Sequence

>3303 : length: 2445
ATAAAAGCCCAGGGGCAAGCGGTCCGGATAACGGCTAGCCTGAGGAGCTGCTGCGACAGT
CCACTACCTTTTTCGAGAGTGACTCCCGTTGTCCCAAGGCTTCCCAGAGCGAACCTGTGC
GGCTGCAGGCACCGGCGCGTCGAGTTTCCGGCGTCCGGAAGGACCGAGCTCTTCTCGCGG
ATCCAGTGTTCCGTTTCCAGCCCCCAATCTCAGAGCGGAGCCGACAGAGAGCAGGGAACC
GGCATGGCCAAAGCCGCGGCGATCGGCATCGACCTGGGCACCACCTACTCCTGCGTGGGG
GTGTTCCAACACGGCAAGGTGGAGATCATCGCCAACGACCAGGGCAACCGCACCACCCCC
AGCTACGTGGCCTTCACGGACACCGAGCGGCTCATCGGGGATGCGGCCAAGAACCAGGTG
GCGCTGAACCCGCAGAACACCGTGTTTGACGCGAAGCGGCTGATTGGCCGCAAGTTCGGC
GACCCGGTGGTGCAGTCGGACATGAAGCACTGGCCTTTCCAGGTGATCAACGACGGAGAC
AAGCCCAAGGTGCAGGTGAGCTACAAGGGGGAGACCAAGGCATTCTACCCCGAGGAGATC
TCGTCCATGGTGCTGACCAAGATGAAGGAGATCGCCGAGGCGTACCTGGGCTACCCGGTG
ACCAACGCGGTGATCACCGTGCCGGCCTACTTCAACGACTCGCAGCGCCAGGCCACCAAG
GATGCGGGTGTGATCGCGGGGCTCAACGTGCTGCGGATCATCAACGAGCCCACGGCCGCC
GCCATCGCCTACGGCCTGGACAGAACGGGCAAGGGGGAGCGCAACGTGCTCATCTTTGAC
CTGGGCGGGGGCACCTTCGACGTGTCCATCCTGACGATCGACGACGGCATCTTCGAGGTG
AAGGCCACGGCCGGGGACACCCACCTGGGTGGGGAGGACTTTGACAACAGGCTGGTGAAC
CACTTCGTGGAGGAGTTCAAGAGAAAACACAAGAAGGACATCAGCCAGAACAAGCGAGCC
GTGAGGCGGCTGCGCACCGCCTGCGAGAGGGCCAAGAGGACCCTGTCGTCCAGCACCCAG
GCCAGCCTGGAGATCGACTCCCTGTTTGAGGGCATCGACTTCTACACGTCCATCACCAGG
GCGAGGTTCGAGGAGCTGTGCTCCGACCTGTTCCGAAGCACCCTGGAGCCCGTGGAGAAG
GCTCTGCGCGACGCCAAGCTGGACAAGGCCCAGATTCACGACCTGGTCCTGGTCGGGGGC
TCCACCCGCATCCCCAAGGTGCAGAAGCTGCTGCAGGACTTCTTCAACGGGCGCGACCTG
AACAAGAGCATCAACCCCGACGAGGCTGTGGCCTACGGGGCGGCGGTGCAGGCGGCCATC
CTGATGGGGGACAAGTCCGAGAACGTGCAGGACCTGCTGCTGCTGGACGTGGCTCCCCTG
TCGCTGGGGCTGGAGACGGCCGGAGGCGTGATGACTGCCCTGATCAAGCGCAACTCCACC
ATCCCCACCAAGCAGACGCAGATCTTCACCACCTACTCCGACAACCAACCCGGGGTGCTG
ATCCAGGTGTACGAGGGCGAGAGGGCCATGACGAAAGACAACAATCTGTTGGGGCGCTTC
GAGCTGAGCGGCATCCCTCCGGCCCCCAGGGGCGTGCCCCAGATCGAGGTGACCTTCGAC
ATCGATGCCAACGGCATCCTGAACGTCACGGCCACGGACAAGAGCACCGGCAAGGCCAAC
AAGATCACCATCACCAACGACAAGGGCCGCCTGAGCAAGGAGGAGATCGAGCGCATGGTG
CAGGAGGCGGAGAAGTACAAAGCGGAGGACGAGGTGCAGCGCGAGAGGGTGTCAGCCAAG
AACGCCCTGGAGTCCTACGCCTTCAACATGAAGAGCGCCGTGGAGGATGAGGGGCTCAAG
GGCAAGATCAGCGAGGCGGACAAGAAGAAGGTGCTGGACAAGTGTCAAGAGGTCATCTCG
TGGCTGGACGCCAACACCTTGGCCGAGAAGGACGAGTTTGAGCACAAGAGGAAGGAGCTG
GAGCAGGTGTGTAACCCCATCATCAGCGGACTGTACCAGGGTGCCGGTGGTCCCGGGCCT
GGGGGCTTCGGGGCTCAGGGTCCCAAGGGAGGGTCTGGGTCAGGCCCCACCATTGAGGAG
GTAGATTAGGGGCCTTTCCAAGATTGCTGTTTTTGTTTTGGAGCTTCAAGACTTTGCATT
TCCTAGTATTTCTGTTTGTCAGTTCTCAATTTCCTGTGTTTGCAATGTTGAAATTTTTTG
GTGAAGTACTGAACTTGCTTTTTTTCCGGTTTCTACATGCAGAGATGAATTTATACTGCC
ATCTTACGACTATTTCTTCTTTTTAATACACTTAACTCAGGCCATTTTTTAAGTTGGTTA
CTTCAAAGTAAATAAACTTTAAAATTCAAAAAAAAAAAAAAAAAA

Protein Sequence

>3303 : length: 641
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD