ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

330

Name

BIRC3

Synonym

AIP1|API2|CIAP2|HAIP1|HIAP1|MALT2|MIHC|RNF49|c-IAP2;baculoviral IAP repeat containing 3;BIRC3;baculoviral IAP repeat containing 3

Definition

IAP homolog C|IAP-1|RING finger protein 49|TNFR2-TRAF signaling complex protein|TNFR2-TRAF-signaling complex protein 1|apoptosis inhibitor 2|baculoviral IAP repeat-containing 3|baculoviral IAP repeat-containing protein 3|inhibitor of apoptosis protein 1|m

Position

11q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133

Pathway

role of mitochondria in apoptotic signaling;PID BioCarta;100106

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

ceramide signaling pathway;PID BioCarta;100206

Pathway

caspase cascade in apoptosis;PID BioCarta;100218

Pathway

sodd/tnfr1 signaling pathway;PID BioCarta;100031

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

tnfr1 signaling pathway;PID BioCarta;100015

Disease

Eosinophilia;FunDO

Disease

Cancer;FunDO

Disease

Ulcerative colitis;FunDO

Disease

Multiple sclerosis;FunDO

External Links

Links to cell senescence gene database

330

Links to epithelial mesenchymal transition gene database

330

Links to ovarian cancer gene database

330

Links to endometrial cancer gene database

330

Links to iHOP

330

Sequence Information

Nucleotide Sequence

>330 : length: 6932
GCATTTAAAAGACAGCGTGAGACTCGCGCCCTCCGGCACGGAAAAGGCCAGGCGACAGGT
GTCGCTTGAAAAGACTGGGCTTGTCCTTGCTGGTGCATGCGTCGTCGGCCTCTGGGCAGC
AGGTTTACAAAGGAGGAAAACGACTTCTTCTAGATTTTTTTTTCAGTTTCTTCTATAAAT
CAAAACATCTCAAAATGGAGACCTAAAATCCTTAAAGGGACTTAGTCTAATCTCGGGAGG
TAGTTTTGTGCATGGGTAAACAAATTAAGTATTAACTGGTGTTTTACTATCCAAAGAATG
CTAATTTTATAAACATGATCGAGTTATATAAGGTATACCATAATGAGTTTGATTTTGAAT
TTGATTTGTGGAAATAAAGGAAAAGTGATTCTAGCTGGGGCATATTGTTAAAGCATTTTT
TTCAGAGTTGGCCAGGCAGTCTCCTACTGGCACATTCTCCCATTATGTAGAATAGAAATA
GTACCTGTGTTTGGGAAAGATTTTAAAATGAGTGACAGTTATTTGGAACAAAGAGCTAAT
AATCAATCCACTGCAAATTAAAGAAACATGCAGATGAAAGTTTTGACACATTAAAATACT
TCTACAGTGACAAAGAAAAATCAAGAACAAAGCTTTTTGATATGTGCAACAAATTTAGAG
GAAGTAAAAAGATAAATGTGATGATTGGTCAAGAAATTATCCAGTTATTTACAAGGCCAC
TGATATTTTAAACGTCCAAAAGTTTGTTTAAATGGGCTGTTACCGCTGAGAATGATGAGG
ATGAGAATGATGGTTGAAGGTTACATTTTAGGAAATGAAGAAACTTAGAAAATTAATATA
AAGACAGTGATGAATACAAAGAAGATTTTTATAACAATGTGTAAAATTTTTGGCCAGGGA
AAGGAATATTGAAGTTAGATACAATTACTTACCTTTGAGGGAAATAATTGTTGGTAATGA
GATGTGATGTTTCTCCTGCCACCTGGAAACAAAGCATTGAAGTCTGCAGTTGAAAAGCCC
AACGTCTGTGAGATCCAGGAAACCATGCTTGCAAACCACTGGTAAAAAAAAAAAAAAAAA
AAAAAAAAAGCCACAGTGACTTGCTTATTGGTCATTGCTAGTATTATCGACTCAGAACCT
CTTTACTAATGGCTAGTAAATCATAATTGAGAAATTCTGAATTTTGACAAGGTCTCTGCT
GTTGAAATGGTAAATTTATTATTTTTTTTGTCATGATAAATTCTGGTTCAAGGTATGCTA
TCCATGAAATAATTTCTGACCAAAACTAAATTGATGCAATTTGATTATCCATCTTAGCCT
ACAGATGGCATCTGGTAACTTTTGACTGTTTTAAAAAATAAATCCACTATCAGAGTAGAT
TTGATGTTGGCTTCAGAAACATTTAGAAAAACAAAAGTTCAAAAATGTTTTCAGGAGGTG
ATAAGTTGAATAACTCTACAATGTTAGTTCTTTGAGGGGGACAAAAAATTTAAAATCTTT
GAAAGGTCTTATTTTACAGCCATATCTAAATTATCTTAAGAAAATTTTTAACAAAGGGAA
TGAAATATATATCATGATTCTGTTTTTCCAAAAGTAACCTGAATATAGCAATGAAGTTCA
GTTTTGTTATTGGTAGTTTGGGCAGAGTCTCTTTTTGCAGCACCTGTTGTCTACCATAAT
TACAGAGGACATTTCCATGTTCTAGCCAAGTATACTATTAGAATAAAAAAACTTAACATT
GAGTTGCTTCAACAGCATGAAACTGAGTCCAAAAGACCAAATGAACAAACACATTAATCT
CTGATTATTTATTTTAAATAGAATATTTAATTGTGTAAGATCTAATAGTATCATTATACT
TAAGCAATCATATTCCTGATGATCTATGGGAAATAACTATTATTTAATTAATATTGAAAC
CAGGTTTTAAGATGTGTTAGCCAGTCCTGTTACTAGTAAATCTCTTTATTTGGAGAGAAA
TTTTAGATTGTTTTGTTCTCCTTATTAGAAGGATTGTAGAAAGAAAAAAATGACTAATTG
GAGAAAAATTGGGGATATATCATATTTCACTGAATTCAAAATGTCTTCAGTTGTAAATCT
TACCATTATTTTACGTACCTCTAAGAAATAAAAGTGCTTCTAATTAAAATATGATGTCAT
TAATTATGAAATACTTCTTGATAACAGAAGTTTTAAAATAGCCATCTTAGAATCAGTGAA
ATATGGTAATGTATTATTTTCCTCCTTTGAGTTAGGTCTTGTGCTTTTTTTTCCTGGCCA
CTAAATTTCACAATTTCCAAAAAGCAAAATAAACATATTCTGAATATTTTTGCTGTGAAA
CACTTGACAGCAGAGCTTTCCACCATGAAAAGAAGCTTCATGAGTCACACATTACATCTT
TGGGTTGATTGAATGCCACTGAAACATTCTAGTAGCCTGGAGAAGTTGACCTACCTGTGG
AGATGCCTGCCATTAAATGGCATCCTGATGGCTTAATACACATCACTCTTCTGTGAAGGG
TTTTAATTTTCAACACAGCTTACTCTGTAGCATCATGTTTACATTGTATGTATAAAGATT
ATACAAAGGTGCAATTGTGTATTTCTTCCTTAAAATGTATCAGTATAGGATTTAGAATCT
CCATGTTGAAACTCTAAATGCATAGAAATAAAAATAATAAAAAATTTTTCATTTTGGCTT
TTCAGCCTAGTATTAAAACTGATAAAAGCAAAGCCATGCACAAAACTACCTCCCTAGAGA
AAGGCTAGTCCCTTTTCTTCCCCATTCATTTCATTATGAACATAGTAGAAAACAGCATAT
TCTTATCAAATTTGATGAAAAGCGCCAACACGTTTGAACTGAAATACGACTTGTCATGTG
AACTGTACCGAATGTCTACGTATTCCACTTTTCCTGCTGGGGTTCCTGTCTCAGAAAGGA
GTCTTGCTCGTGCTGGTTTCTATTACACTGGTGTGAATGACAAGGTCAAATGCTTCTGTT
GTGGCCTGATGCTGGATAACTGGAAAAGAGGAGACAGTCCTACTGAAAAGCATAAAAAGT
TGTATCCTAGCTGCAGATTCGTTCAGAGTCTAAATTCCGTTAACAACTTGGAAGCTACCT
CTCAGCCTACTTTTCCTTCTTCAGTAACAAATTCCACACACTCATTACTTCCGGGTACAG
AAAACAGTGGATATTTCCGTGGCTCTTATTCAAACTCTCCATCAAATCCTGTAAACTCCA
GAGCAAATCAAGATTTTTCTGCCTTGATGAGAAGTTCCTACCACTGTGCAATGAATAACG
AAAATGCCAGATTACTTACTTTTCAGACATGGCCATTGACTTTTCTGTCGCCAACAGATC
TGGCAAAAGCAGGCTTTTACTACATAGGACCTGGAGACAGAGTGGCTTGCTTTGCCTGTG
GTGGAAAATTGAGCAATTGGGAACCGAAGGATAATGCTATGTCAGAACACCTGAGACATT
TTCCCAAATGCCCATTTATAGAAAATCAGCTTCAAGACACTTCAAGATACACAGTTTCTA
ATCTGAGCATGCAGACACATGCAGCCCGCTTTAAAACATTCTTTAACTGGCCCTCTAGTG
TTCTAGTTAATCCTGAGCAGCTTGCAAGTGCGGGTTTTTATTATGTGGGTAACAGTGATG
ATGTCAAATGCTTTTGCTGTGATGGTGGACTCAGGTGTTGGGAATCTGGAGATGATCCAT
GGGTTCAACATGCCAAGTGGTTTCCAAGGTGTGAGTACTTGATAAGAATTAAAGGACAGG
AGTTCATCCGTCAAGTTCAAGCCAGTTACCCTCATCTACTTGAACAGCTGCTATCCACAT
CAGACAGCCCAGGAGATGAAAATGCAGAGTCATCAATTATCCATTTTGAACCTGGAGAAG
ACCATTCAGAAGATGCAATCATGATGAATACTCCTGTGATTAATGCTGCCGTGGAAATGG
GCTTTAGTAGAAGCCTGGTAAAACAGACAGTTCAGAGAAAAATCCTAGCAACTGGAGAGA
ATTATAGACTAGTCAATGATCTTGTGTTAGACTTACTCAATGCAGAAGATGAAATAAGGG
AAGAGGAGAGAGAAAGAGCAACTGAGGAAAAAGAATCAAATGATTTATTATTAATCCGGA
AGAATAGAATGGCACTTTTTCAACATTTGACTTGTGTAATTCCAATCCTGGATAGTCTAC
TAACTGCCGGAATTATTAATGAACAAGAACATGATGTTATTAAACAGAAGACACAGACGT
CTTTACAAGCAAGAGAACTGATTGATACGATTTTAGTAAAAGGAAATATTGCAGCCACTG
TATTCAGAAACTCTCTGCAAGAAGCTGAAGCTGTGTTATATGAGCATTTATTTGTGCAAC
AGGACATAAAATATATTCCCACAGAAGATGTTTCAGATCTACCAGTGGAAGAACAATTGC
GGAGACTACAAGAAGAAAGAACATGTAAAGTGTGTATGGACAAAGAAGTGTCCATAGTGT
TTATTCCTTGTGGTCATCTAGTAGTATGCAAAGATTGTGCTCCTTCTTTAAGAAAGTGTC
CTATTTGTAGGAGTACAATCAAGGGTACAGTTCGTACATTTCTTTCATGAAGAAGAACCA
AAACATCGTCTAAACTTTAGAATTAATTTATTAAATGTATTATAACTTTAACTTTTATCC
TAATTTGGTTTCCTTAAAATTTTTATTTATTTACAACTCAAAAAACATTGTTTTGTGTAA
CATATTTATATATGTATCTAAACCATATGAACATATATTTTTTAGAAACTAAGAGAATGA
TAGGCTTTTGTTCTTATGAACGAAAAAGAGGTAGCACTACAAACACAATATTCAATCAAA
ATTTCAGCATTATTGAAATTGTAAGTGAAGTAAAACTTAAGATATTTGAGTTAACCTTTA
AGAATTTTAAATATTTTGGCATTGTACTAATACCGGGAACATGAAGCCAGGTGTGGTGGT
ATGTGCCTGTAGTCCCAGGCTGAGGCAAGAGAATTACTTGAGCCCAGGAGTTTGAATCCA
TCCTGGGCAGCATACTGAGACCCTGCCTTTAAAAACAAACAGAACAAAAACAAAACACCA
GGGACACATTTCTCTGTCTTTTTTGATCAGTGTCCTATACATCGAAGGTGTGCATATATG
TTGAATGACATTTTAGGGACATGGTGTTTTTATAAAGAATTCTGTGAGAAAAAATTTAAT
AAAGCAACAAAAATTACTCTTATTCTTCATTGCTTTATTTCAATGACATTGGATAGTTTA
GTCACTCCCAGACTCTTTCCATACCTTCTTAAAGCCTCTCAAATATTGAACTACAGTTTA
TACTCCTTCCCATAAGATGCTTCTTCATTGACACTTGTAGAACACGGGGTCAACACATCA
TAAAATCTATTATGGAATGCCTGAGACAAGAATCAAACAGTCCCTTTAGTAAGTTTGTTT
ATTCACTTCTCTATTGATTCATTCAAGAAGTCTCATGCCAGCCCCACCTATTGGAAGAAG
GTCTGAGTTTTATTCTTATCTCTTTGGTATTAATTCTGAAACTTAGAAAGTACACTGGTT
AGCAATGCTTGGGACCAACAGGTTGTTCTGGTAAATAAATCTGTTTCATATTGTCAGTGC
AACAAAATGTCCCCCTCTGCATTATGTTATTGGTACTCAACACGTCCGAGTCATAACTCT
GTCCTTTGCTTCTTATAGAGGTATTAGGTCTTCAAGAGCAGAAGTAAGACTGTAATAGGG
AATACTCAGGGGAAGGCAGGCAAAGGCTAGTCATCTAAACCAGTTCTAGATGTCTGTATA
GGGGCAGATGGCTCTGTAAGGGCAGAAGGGAAAGACCCCTTCATAAGGGTCACAGCTGAC
AATCCTATAACAAAAGACAGGTTAACAAGAGAAAAACTTAACAAATTTATTTAATCACAG
ATTTACATCACCGGGGAGCCTTCGTAATGAAGATCCAAAATTACAGGGGAAACTGTGCAT
TTTTATGCTTAGGTTTGATAATGAATGGACAGCCCTGAAGAATAGTGATTGGAAAAAAAG
GATATGATCTAATGGGAATAGACACAGGTTGGGGACCCAGCAAGGCCTGTCTGTTCAGAT
TATTCTTGGTCTCTGTGCAGCATTCCTTCCTCCTGGATATAGGGCAGGGCCTGTATGGGA
TGGGGATATTATAACCTGCTATCAAGCAAGGTAGGTCAGAGAATTTATTTATGGCCAGCT
CTTACATAGTTAGGTGAGGAAAGATTAGAGTACTATCTTTAAGATGTAAGTCTGGCATTG
TGGAAAGATGGTTCCAGTTTCTATGACCTACCTTGGGGAAGAGGAATTCAAGTTTCTGTG
GCTTGCCTTCAGGGAGAATGAGGCTGAGACAGGAGGGCAGGATAACATCAGAGAAAAACT
TTGCTTCTGAGGCCTTCACTTTGGGTTTTCTGAGCCCCAACATCTGCTAGTGTTGTAAAG
AGAACAATTAGGGACCAAGTGAGGGGAGGAAAGAATCCATCTCTGCATTCTGATGCTGGG
AGACTTATTTCCTTGAAATGCAATTGATTTTGCCTCTGCTAAGAGGCTCTGCTGGCTACC
CATGTACTAGCCAGTGTCCTGCATGGGTGCTAGGCTGAATTATTTGTAATTGTGCTTAGG
TGATTTGTAACTCAGGTATAGGGTATTTAAATAGTAGGCACCCTTTTTGCACCATGTGTT
TTTTTTTTTATCTAGTTCTTGTATACTACAGATAATATTTGAACTTTGTCATCTCACTGT
AAAACTTTTGTTCATTTCTCATTATGGTAATAAATAGCTATTATAACCAACCCATTTATT
CAAATATGTTATTTCCCTAAGTGTTATTTTGACATTTTGTTTTGGAAAAAATAAATCACC
ATAGATAATAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>330 : length: 604
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS