ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

329

Name

BIRC2

Synonym

API1|HIAP2|Hiap-2|MIHB|RNF48|c-IAP1|cIAP1;baculoviral IAP repeat containing 2;BIRC2;baculoviral IAP repeat containing 2

Definition

IAP homolog B|IAP-2|NFR2-TRAF signalling complex protein|RING finger protein 48|TNFR2-TRAF-signaling complex protein 2|apoptosis inhibitor 1|baculoviral IAP repeat-containing 2|baculoviral IAP repeat-containing protein 2|inhibitor of apoptosis protein 2

Position

11q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

role of mitochondria in apoptotic signaling;PID BioCarta;100106

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

Canonical NF-kappaB pathway;PID Curated;200026

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Apoptotic cleavage of cellular proteins;PID Reactome;500270

Disease

Schizophrenia;FunDO

Disease

Cancer;FunDO

Disease

Multiple sclerosis;FunDO

External Links

Links to cell senescence gene database

329

Links to epithelial mesenchymal transition gene database

329

Links to ovarian cancer gene database

329

Links to endometrial cancer gene database

329

Links to iHOP

329

Sequence Information

Nucleotide Sequence

>329 : length: 4088
GCGGTGAGTGCTGCTCCTTCCGGGCTCGGGCGGCGTGGGGCGGGTGGGGACGCGAGGGCC
CGCGGGGGCCCACTTCCCTGATGTGGCGGCGAACGAGGAAGGACGGGGCCTGAGGCCCTT
CGGCCAAGGGTCGAGGGTCGCCGGGGGCTCTCTGCTTTCTACTCTCGCCAAGGTTTTATT
GGATTCGGAAGCCCCAACTTCGAGACTTGCAGTCAAAGCGATTTTTAAAATGACTTGTTT
TCAAGCCTCTGGCCGCCGCCCACTCTTCTGGCCCTTGGACTTTGACCAAGATGTTTTCTC
GCAGTTTTTGCAAGGTTTTAAACTTAGCCCTCGGCGTTCTTTTAATGTAATACATTGAAA
CGAAGATATTTCGGTGGCGGCGATATTTCATATTTCATAGTTGCCACTGCGCTCTGTCAT
TCCAGTAGTCGTCTGTTGTGTATTGTGAGAAGCAACTCTGGGAAATTATTGGATTTACAA
CCCTGAAGAATCTCCCTATCCCTATTTTGTCCCCCTGCAGTAATAAATCCCATTATGGAG
ATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGA
ATTATATTTTTAAAACATTGAAGAGTTTTCAGAAAGAAGGCTAGTAGAGTTGATTACTGA
TACTTTATGCTAAGCAGTACTTTTTTGGTAGTACAATATTTTGTTAGGCGTTTCTGATAA
CACTAGAAAGGACAAGTTTTATCTTGTGATAAATTGATTAATGTTTACAACATGACTGAT
AATTATAGCTGAATAGTCCTTAAATGATGAACAGGTTATTTAGTTTTTAAATGCAGTGTA
AAAAGTGTGCTGTGGAAATTTTATGGCTAACTAAGTTTATGGAGAAAATACCTTCAGTTG
ATCAAGAATAATAGTGGTATACAAAGTTAGGAAGAAAGTCAACATGATGCTGCAGGAAAT
GGAAACAAATACAAATGATATTTAACAAAGATAGAGTTTACAGTTTTTGAACTTTAAGCC
AAATTCATTTGACATCAAGCACTATAGCAGGCACAGGTTCAACAAAGCTTGTGGGTATTG
ACTTCCCCCAAAAGTTGTCAGCTGAAGTAATTTAGCCCACTTAAGTAAATACTATGATGA
TAAGCTGTGTGAACTTAGCTTTTAAATAGTGTGACCATATGAAGGTTTTAATTACTTTTG
TTTATTGGAATAAAATGAGATTTTTTGGGTTGTCATGTTAAAGTGCTTATAGGGAAAGAA
GCCTGCATATAATTTTTTACCTTGTGGCATAATCAGTAATTGGTCTGTTATTCAGGCTTC
ATAGCTTGTAACCAAATATAAATAAAAGGCATAATTTAGGTATTCTATAGTTGCTTAGAA
TTTTGTTAATATAAATCTCTGTGAAAAATCAAGGAGTTTTAATATTTTCAGAAGTGCATC
CACCTTTCAGGGCTTTAAGTTAGTATTACTCAAGATTATGAACAAATAGCACTTAGGTTA
CCTGAAAGAGTTACTACAACCCCAAAGAGTTGTGTTCTAAGTAGTATCTTGGTAATTCAG
AGAGATACTCATCCTACCTGAATATAAACTGAGATAAATCCAGTAAAGAAAGTGTAGTAA
ATTCTACATAAGAGTCTATCATTGATTTCTTTTTGTGGTAAAAATCTTAGTTCATGTGAA
GAAATTTCATGTGAATGTTTTAGCTATCAAACAGTACTGTCACCTACTCATGCACAAAAC
TGCCTCCCAAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGA
TAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTC
CTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGA
AAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTT
CTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAA
ACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCAC
CTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGA
ACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAG
AGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGA
AGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATT
GGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGG
TGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTT
TCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCT
GAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCC
AGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGT
CAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGT
AGAACATGCCAAGTGGTTTCCAAGGTGTGAGTTCTTGATACGAATGAAAGGCCAAGAGTT
TGTTGATGAGATTCAAGGTAGATATCCTCATCTTCTTGAACAGCTGTTGTCAACTTCAGA
TACCACTGGAGAAGAAAATGCTGACCCACCAATTATTCATTTTGGACCTGGAGAAAGTTC
TTCAGAAGATGCTGTCATGATGAATACACCTGTGGTTAAATCTGCCTTGGAAATGGGCTT
TAATAGAGACCTGGTGAAACAAACAGTTCAAAGTAAAATCCTGACAACTGGAGAGAACTA
TAAAACAGTTAATGATATTGTGTCAGCACTTCTTAATGCTGAAGATGAAAAAAGAGAAGA
GGAGAAGGAAAAACAAGCTGAAGAAATGGCATCAGATGATTTGTCATTAATTCGGAAGAA
CAGAATGGCTCTCTTTCAACAATTGACATGTGTGCTTCCTATCCTGGATAATCTTTTAAA
GGCCAATGTAATTAATAAACAGGAACATGATATTATTAAACAAAAAACACAGATACCTTT
ACAAGCGAGAGAACTGATTGATACCATTTTGGTTAAAGGAAATGCTGCGGCCAACATCTT
CAAAAACTGTCTAAAAGAAATTGACTCTACATTGTATAAGAACTTATTTGTGGATAAGAA
TATGAAGTATATTCCAACAGAAGATGTTTCAGGTCTGTCACTGGAAGAACAATTGAGGAG
GTTGCAAGAAGAACGAACTTGTAAAGTGTGTATGGACAAAGAAGTTTCTGTTGTATTTAT
TCCTTGTGGTCATCTGGTAGTATGCCAGGAATGTGCCCCTTCTCTAAGAAAATGCCCTAT
TTGCAGGGGTATAATCAAGGGTACTGTTCGTACATTTCTCTCTTAAAGAAAAATAGTCTA
TATTTTAACCTGCATAAAAAGGTCTTTAAAATATTGTTGAACACTTGAAGCCATCTAAAG
TAAAAAGGGAATTATGAGTTTTTCAATTAGTAACATTCATGTTCTAGTCTGCTTTGGTAC
TAATAATCTTGTTTCTGAAAAGATGGTATCATATATTTAATCTTAATCTGTTTATTTACA
AGGGAAGATTTATGTTTGGTGAACTATATTAGTATGTATGTGTACCTAAGGGAGTAGTGT
CACTGCTTGTTATGCATCATTTCAGGAGTTACTGGATTTGTTGTTCTTTCAGAAAGCTTT
GAATACTAAATTATAGTGTAGAAAAGAACTGGAAACCAGGAACTCTGGAGTTCATCAGAG
TTATGGTGCCGAATTGTCTTTGGTGCTTTTCACTTGTGTTTTAAAATAAGGATTTTTCTC
TTATTTCTCCCCCTAGTTTGTGAGAAACATCTCAATAAAGTGCTTTAAAAAGAAAAAAAA
AAAAAAAA

Protein Sequence

>329 : length: 618
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS