ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3267

Name

AGFG1

Synonym

HRB|RAB|RIP;ArfGAP with FG repeats 1;AGFG1;ArfGAP with FG repeats 1

Definition

HIV-1 Rev binding protein|HIV-1 Rev-binding protein|Rab, Rev/Rex activation domain-binding protein|arf-GAP domain and FG repeat-containing protein 1|arf-GAP domain and FG repeats-containing protein 1|hRIP, Rev interacting protein|nucleoporin-like protein

Position

2q36.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3267

Links to epithelial mesenchymal transition gene database

3267

Links to ovarian cancer gene database

3267

Links to endometrial cancer gene database

3267

Links to iHOP

3267

Sequence Information

Nucleotide Sequence

>3267 : length: 9483
TTTGTACCATGGTTGCACTAATACTTTCAACAGCTCCCTTAAAATGCACTTTGAAAACAA
TAGCCATCATTTAATTGTAGGATATGCAGTAAAGGAAAAGAATCTTATATTTTGATCAGA
TTGATAGAAAGTGGTTAATCTTAACTGTTTTGTTCCTTGTCTGAAGAAAGAATGAAATAG
CTACATGTAGGCTGTGAGTCAGGCTGCCTGAGAGGAGTTGTTTTTTAGTCTGAAGTTCTT
AATTACAAATGACTGCTCAGATTACCTTTTTTTTCTTTACTTTATTTGACTTTTGGTTTC
ATTACAGGAGAATAAAATGTATATGCCTGTTACAAGAAGAAACTACTGAATTACTCATTT
ATTTTTCCTTCTACTATGGTTGATACCATCTTTTGACGTTTTGCCTTGGAGTAGTTTTTA
GTTAAATACTAGGTCATGGTTTAACTGAAATGTCTTTTTCCAGAGCCTTTCCAAGCATTC
AGAATCCTTAGTTTTCCATATATAGTTCAGAAAGTCATTGATTGCCAATTTCTTCTCATC
CTGATATTCTTGTTAATTTTAAAAAAAATTAGGTGAAAATTTTATCCTGAACAGTTTGAT
ACGACTGATGGAACCATTAATGGCAAATGATAATTATTCACATATGCCAGTCTGGTTCAT
TAGCATTGTTTTGTAGGGAAACTTTTTCTTTTGTAGATAATTTAGTGTGACTTAAAAGCC
AGAAGCCTTTAGTCTTCATGTGAGCATTCAGGCTGAGGTATAGTATTTGTGGATGTGTGT
TGCTGGGTGGGGTCATTATTGGGTTCAGAAAAAGTCATCTTCTACAGAAAGACGCATGAA
GCTAGAAATAAAATTCACCTACTGAATTTGGTTATTTTGCCTGATGATAAACATCATATC
CCAAAACCTGTGCACTGTAAACTGTAATTGATTTTTGTCACATTCTATACTGTAGGATCT
AAACCCAACTGCCTTGCAACTCAGGTAACACAAATGAGTAGTATAATGTTGTGTTTAAAG
AACTATGGTGCCCTTTTTAAAGGGGATGTTCTAATCTGTTACCACATGGAAATAGGGGTT
TAGGATACTAGATATATTGATTTTTTTTTTTTAATAAGAGAAGCTAGAAGTCTTTTTGTT
TATTGTGAAGTGCCCTCTTTTTAAATGTTGGGAATTCATGGGAAATAATGTTAAATACTA
TACAGATGAAACAAAGCATATCTGTCAGATGAATTTGCTGAGGGCTGCTAGTTTGCGTCC
TATGATCTATCTTCCTGTCTCATGAATATGTGTTTTTCTTTGAAGAGGAATGACAACTAT
TAGCAAGACTCAGGCTCATTAATTTGGGGTCTTAAGTTCCACACTAAGTTGACTCCTTTG
TACTTTTTGAAATACGATTATTCAAGAAACAGCTTTACCATTGTGTTACATTCTGCTTAG
CTTGGATTTCTTTGTACAGAGATTGCCTGAGTGTCCAGACAGTAATTTTTGTATTACTGA
ATTTATTAGTGTTGAATTTGCAAAGTTGTGTTTTCCAAAGTTTCATTCTGCAGCACTTAT
AATCGATTGTTGAAGATAGTGAATAGATCAGTACCTAGAAGTAAAAATGGATACAAGTAC
TACAAAGTCCTGTCTTGCCTATTTAATAGCTCAGAATTCTGCAAATGCAGATTTTGCAAA
CTTTGATGCATTTGGACAGTCTAGTGGTTCGAGTAATTTTGGAGGTTTCCCCACAGCAAG
TCACTCTCCTTTTCAGCCCCAAACTACAGCATTTAGAATGCTTTCATCTAGCTGCAGTTT
TGGTGAATTTACTTCAGCTTTTCCTCTTCAGGCTACCCACAGTGGAAGTGCTGCATCAGT
AAATGCTAATTTTGCTCATTTTGATAACTTCCCCAAATCCTCCAGTGCTGATTTTGGAAC
CTTCAATACTTCCCAGAGTCATCAAACAGCATCAGCTGTTAGTAAAGTTTCAACGAACAA
AGCTGGTTTACAGACTGCAGACAAATATGCAGCACTTGCTAATTTAGACAATATCTTCAG
TGCCGGGCAAGGTGGTGATCAGGGAAGTGGCTTTGGGACCACAGGTAAAGCTCCTGTTGG
TTCTGTGGTTTCAGTTCCCAGTCAGTCAAGTGCATCTTCAGACAAGTATGCAGCTCTGGC
AGAACTAGACAGCGTTTTCAGTTCTGCAGCCACCTCCAGTAATGCGTATACTTCCACAAG
TAATGCTAGCAGCAATGTTTTTGGAACAGTGCCAGTGGTTGCTTCTGCACAGACACAGCC
TGCTTCATCAAGTGTGCCTGCTCCATTTGGAGCTACGCCTTCCACAAATCCATTTGTTGC
TGCTGCTGGTCCTTCTGTGGCATCTTCTACAAACCCATTTCAGACCAATGCCAGAGGAGC
AACAGGCCTTTCTGGAGCAATGCATTCTCAAGTGTTTCCTCACGCTCATTTTGCGGCAAC
CTTTGGCACTGCATCCATGAGCATGCCCACAGGATTCGGCACTCCTGCTCCCTACAGTCT
TCCCACCAGCTTTAGTGGCAGCTTTCAGCAGCCTGCCTTTCCAGCCCAAGCAGCTTTCCC
TCAACAGACAGCTTTTTCTCAACAGCCCAATGGTGCAGGTTTTGCAGCATTTGGACAAAC
AAAGCCAGTAGTAACCCCTTTTGGTCAAGTTGCAGCTGCTGGAGTATCTAGTAATCCTTT
TATGACTGGTGCACCAACAGGACAATTTCCAACAGGAAGCTCATCAACCAATCCTTTCTT
ATAGCCTTATATAGACAATTTACTGGAACGAACTTTTATGTGGTCACATTACATCTCTCC
ACCTCTTGCACTGTTGTCTTGTTTCACTGATCTTAGCTTTAAACACAAGAGAAGTCTTTA
AAAAGCCTGCATTGTGTATTAAACACCAGGTAATATGTGCAAAACCGAGGGCTCCAGTAA
CACCTTCTAACCTGTGAATTGGCAGAAAAGGGTAGCGGTATCATGTATATTAAAATTGGC
TAATATTAAGTTATTGCAGATACCACATTCATTATGCTGCAGTACTGTACATATTTTTCT
TAGAAATTAGCTATTTGTGCATATCAGTATTTGTAACTTTAACACATTGTTATGTGAGAA
ATGTTACTGGGGAAATAGATCAGCCACTTTTAAGGTGCTGTCATATATCTTGGAATGAAT
GACCTAAAATCATTTTAACCATTGCTACTGGAAAGTAACAGAGTCAAAATTGGAAGGTTT
TATTCATTCTTGAATTTTTCCTTTCTAAAGAGCTCTTCTATTTATACATGCCTAAATTCT
TTTAAAATGTAGAGGGATACCTGTCTGCATAATAAAGCTGATCATGTTTTGCTACAGTTT
GCAGGTGAAAAAAAATAAATATTATAAAATATGCTATTGTTTTTGTGTTCTTGCTGCAAT
GCCTTTACCAAAGTGGCCTTAAATATGAGTAGTGAATTGAGAACATCTTGAATTCTTAAA
AGACTTCTTAGTGACTTTTTATAAAAAGGCCATGTAGAAAATTTATTAAAACTACTATGA
CTGCTACATTCAGGAATATGCCAGTGGTAAAGCATTTAAATGTAGCTTGTCAGATTTACC
ATAATCCTACTAATTTCTTTGCAGCTTATTAATTTTGTGAAATTTGTATATATGAAGAAT
TTGCATGTATGTGTATTTACAAATTTTTCTAAGTATCTTGAATTCTCAGACTGCAAAAGG
CCTATTTTAACTATTGATTTTTTTTAAAAAAAATTGTCTTTGAATGTATTGGAAGTAGAC
ATGCATTAACTGTGACATTATTGCACCTCAGTTTTTTTCTTTCTTTTTTTGGGCAAACTG
ATATTATCTATAGGATATTTGTTTATGTTTGTTTTTTGGGGGAAAGAAACTGGAACTCAG
TGTTACCTTAAAGTTACGGAATACTTTGTTTTAAAGGAAAAGATAATAAGTTTAGTTATA
TCTTTTTGTTAATATTCAAATGAACTTGTTTAAGTATCTATGTACAGTAATGCCTCATTC
ATCTAGAGGTAATCTGGCAGTCTTGTGAAAACCGAACACAACTCAGAAACTTGGAATCGT
TTTTTTTAAAAATGCCTCTGAGCAACCCATATAAGTCACAAAGTCTGTGTGTTAGAGCTT
ATGCATTTGTTTTTATGAGAGATTTTAATAAATTTAATTATTTGCTTGTCCAGACTATAG
CATATTAGCTGTTTAGAAGGGATGGCTTGAAAGGAAGGAGACTGAAAAACACTCTGAGAG
CATACACTGTCCAAGGCCATTAGTGTAAGGACCGCTACCCAGCCTAGAGGACATCACTAT
ACTACATCATCTGATGATTATTCTTTATTATGCCTCTAGGTAATTAAGTAAAGGTGAAAT
TGCATACACAGATATGTAGTACATATTTTAAAAGTTTTATCTTAAATTGATTAAAACTTT
TTAAAAAGCTTTGGTATTAAAAGAGGTAAACATCAGTTTCCTCAAACATTTTATTCATGT
TGAATGCCTTTTTGCAATGATGACTGAGTTGTTATCATAGTATTTTAAAACCTGTATAGT
GTTTTAGACTTGTTAAAACATTGCTGTCTAGTGTACATCTAGCTAAAAGTGTGGTTTATC
TAAACCGTTTTAATAAGCAAGATGACTGGGAAATCTCTGCCCCTTTTCTGAGCAGTATGC
CTCTTCTTTTAGAATTAAATGAATGCTGCACAGGTCCAGATGTGTGTTGATGTAGACTTG
AAATGTCTCCACATTTTGGAGGACTTCCTCAGCCCTTTTCATTGAGGGAAAATATATTTG
AATTTCTGTTTTAGATTGTATCGGGTCCCAGTTGATTCATGTGTACAAAGTTATGCTACC
TAATTACAGACCATTACCCAAATATCCTACCAGGCTTTCCATCTGAATAGTAAATTAAAC
AGTTGTTATCAAAATGATTTTAAAGACTATTTCTTTTTCTGGGTAACTATTGAAGTTTGT
AATTAAATGGGGGCTCTTACTGACTTTAAATTAGCGCTTATAAAATAAAAATGTTTAGTT
CAAGAAGAGACCCAAGCTGGGTATGGTGGTGTGAGAGCCTGTGAGTCCTAGCTACCTGGA
GGTGAGGTGGGAACATCACTTGAGCCCAGGAGTTGGAGGCTGCAGTGCGCTACGATCACA
CCACTGCACACCAGCCTGGGGATAGAGTGAGATCCCATCTCTAAAAAATGAAAAAAAGAA
GAGAGGTAGCTTTAAAGTGGTTTTTCTCATGATATTCACTGTTTATTATTAAAGAAAATC
AGCTTTCGTTAGACTTTTACATTTAGATTTATTCTAGTTTTATATAGACCATCAAAATTA
TGTTGAGTACTAAAAAGGAGAAAAAATCCTGGAAGGTAACAAGGCTGAAGACCTTCAAAT
TTCCTGGCTTACTGGTTTAGTCACATCATTTTTCCTGTTCAGGTATCTGCAGATATCCCT
GTTCAGGAAAGATCTTTTTTCAGGATGGCAAACTTTTGACATAGTTTAAAGACATTTTTT
CCCCATTTTTTGAAATAGAGAATATTTTATTATTTTTGTGAAAATAGAGTTTTGGTAATC
ACTTTCTTCCTCAAAATAAGTCCTTCTGTTAATTTGTAAAAGCACATTAGTGCTTTACCT
GTGAAATTCCCCGCCCCCCTGCACACACACCCACTTTAGTACAGTTCCTGTCAATTGGCA
ACATGGAGAGGGTGACCTGGCTGCTGGTTTACCACTGTACCAACATCTCTGGAGCATTTT
AGTTTCAGAACCTTAACACTCCCCAACAGCTTTGTTGATGTAGCTTGTATCTCTGAGAAT
TTATTGTATTAAAATTAATACTGAGATATTTTTAAAACATGTTTATTTATTTAAGTATAA
CAGTAATAAACTAATAACTTGCTAACATAAATACCATTTTTGATAAAAATAACTTTTCCA
AAACAAAAACTAATGAGAACAGGAACATTGTTTTACATTTTATGCATTTAAATCTGGCTT
AATAAAAGCAGTGAGATTTTCATGCTGCTTTTGCATTCCAACTTAAAAATTACACAGCAT
ACACACGCTGGAAAACTCCACTGTGCACTTGTGAGATCAGGAGAATGAAAACTATGTAAT
ATCTCAGTAGTACAATGAAAATAGTTTGACTTTTCACAGCCTTTCAAAGAAAGGGTTGTA
GGGACCATTAAGGGTCTCCAGACTCTTTGAGAACCACTATACTTTAAATTTGTGTATTTC
TAGAACAGTATTTACTTGCAGGGCAAACATAACTATTCCCTGGGTTTTTTTTGTTTGCTA
GTGAGAACTGAAATTGCAGACTTTTTAACACTACTTCAAGGTAATAATAGCAGTGGTATT
ATGGGCTGTGTATGAGATAGTCATTTGTAAAACAATTTTCATATTTCATCTCTTACAATC
CCTGCAGTGGACCTATACTTTTAGGATGAAAGAAGCAAAGCATAGAGAGGTTAAGCTAGT
GGCAGCTTTTTGCTCTGGGGAACAGATTTGGATTAAATGCTATCACATTTATATATGAAT
GCATTCTTTCTTAATATTTTGAAATTCTGAACAAGTTAACGTTCTTGTCTTGTATATCTA
AAAAAACTTTAATCACTTGAATTCCTTTCATAATTTGATGAAATCAGTACAGTTTATTCT
TGGTTTTTTTTTTTAACTTTAGAAGTAAATTAATATGGTAACTAGTGGAGCGTGCTTTAG
ATTGAAGACTCATCTGAAGTATCACAGACTCCTATTTTGTAAAGCATTCCACCTTTATTG
ATACAGTTTGTGGCCTATACACTTTTAAAATTTATTTTTTAAAAGGTGATATTAAAATTT
GTATTTAACCTGTTGTATTCATCCTCATTAGTTAAGTTTTTCTTTTTATGTTTTAAAACT
TAGTGACATTAAACTTTTCACGTGGTTGTTTGTGAACAGATGAATATATAACCACGATGT
AATCCAGTGTTGTGCTGCTGAATGTTTAACAACCATCTTTCATGAAAGAAAAAAGGCCCT
GTTTTGTAGCATTTACTAATATTTATGGTATAAATACTGTCTTCATGGTGATTTTACCTG
CCAATCTGATGTCATTAAATGCAGTTTGATGAAAGAGATAGCCAACCAGTGGCTTTCCCA
AGCCTTGGCAAACCAGCTTCAGCACAGCAAAGGACATACAATTCCACAACTCATTAATTA
AATGTATTGGTCATTTGATGATTATATCCAGTATTTGGAGAGCTTTTATATTGTTAATTC
ATTTAGCAAGCATTTGAACACTTGTTTATTTTTAGAGATATACTGGGCACTGAGGTATTT
AATCTGCAAAGACCCAAGTATCGTGAACCTTGGTTTTAAAAAGTCCAATTATTGTGCTCT
TATAGGGGTTGCACATTCAAGGCTTACACTGAATTCTGTCTGCAGTTCTGTTTTGTGTGA
CCAGCACAGTGTTTTAAAACGTTGCATTCTGAATCCATCTTTTTGAAATGGGGCATGTAC
TCTTAAGGTGGCCACTAGCTTACCATTCCCAATTTTTCTTAGTCTCAAACATTCACATGT
TTTTCAAGGCCTTGGAGTTGGCAAATCCTGAATATATAGTGAAGGTAGGAAATAGCTCTT
CTTATGCCACATCTTAGTCTGATTTTGAAGTCAGTTGTGTAAGTTTGGGCTGACAGTGGT
ATTTTCCAGTGAAGACTATCGCCAAGAATGCATATCATTCTGCTTATTTTATTCTAGTGG
ATAAAAATTCAACGTATATTTAAGTGTATTTTTGACATCTGTGCTTGTCCAACACAGGGC
TGTAGGGACTGATGAAAAGAGAATGTTGTGATTTGAGCTTTTATAAAAAAAGATAAGTGA
TCCTAGATAAAATATTTTAGATGGTGATTAAAATGCCCATAGATTAATTTTTTAATCGGT
TCTCTGAAATCTTGAGATGTTATCCAAGTTACAATTTAAGCAATGAGAGTAAAATTTGAA
TTCTAAATTCTCAGCATCTTCCCTCATTCTTGAGTGGAGAGACAGAGGAAGCAAACGCCA
AGGAGCCTTCTAATTTTGACTATATGATCATTAACTAAAGGCAGCAAGGGATTGTAAACT
AATCTTACATAGTCAATGTTTCATAGAATGCTTTGGTTACAATCAGGTTTTTTAAAGACT
TTAAAGGTTTTTTGTATGCTATAATATATGCTTATGATTTCTAAAAATTATGCAGTATAC
ACAAAGGGCATAAAGTCAAAAAGTGTGTCTCCCTCTGTGACTTTATTCTCATACCCCAGA
GGCATATAATTTCTTGTATTCTTGTGTAGTCTTTAAGAAATGTTATCGTTTATTTTATAT
ATGGCTCTCTCTCTGTATGCCTCTTCCTGTTCTTATTTTAAATGTTCAAGTTTGTGACTT
GGTTCTTGTTTAACTTGGTTGTCTTTCCATATTGCCACCTTCCAGCTCTAACATTAATGT
CTCCAGGATTCCATTATATGGATGTCCCTTTGGGAGAACATTTGTTTATAGACTTTTCTA
CTAAAAATATTGTTATAATGATAATATCCTTATGCATATATGAAGATTACTCTTGATTCT
GCCTGACTGGAAACTTTATTAATAAAGTAGACATTATTCTATTTTGAGGCTCACCAGCTG
TGTAGGTATGATCTTGTGCTTCCATTTAAGAAATTCTTCCATTTAAAGAAGAAAAAAAAT
CTCTCTGACTATCTGAAGATATATGAAAAAGCCTATGCTTTTAAATTAAACTGTTAAGAC
AGTCCATTGAAAGATTGTGGAAGTTCACATCTATTTTGCACCTTAATTTTTTCATTGTCC
CTACTCATGACTCTAAAAAGTGCATGGCTTGGGGCTATACTTTGTTTTGCAGTTTGTTGG
TATCGTGCCTTTCCTTATCTACATTAGCTTAGACTATACCTTATTTTTAAGAAGAGAAAG
TGGAAATTAACTGTGGCAAAACCTATTTTGGCACAACCACATTTGTTCATTATACAAAAT
TAGCTTCCTATGCTTTAGAAAAAATGTGAGTTATTACTCTGAAAGTTGTGATTCTGATTC
CTCATGGTTTGGAGCTCAGAAATTTCTTAACATGTCTTTGCTGTTAGTCAAGCACAGGAT
TTGTTTTCTGCAAAAGTTTATTTTCAATGAAGAATACTTGTCCTAATAGCTCATAAAAAG
TACCTTTGCACTTTAAATCCTAGGAATAGGGAACAAGGAAACTTACTGGGAAGTTCAAAA
GAAAGAATAACAGGACCTTCTAGTCAGCAGGGCATGTTTGGAAAATGTTAATACGCCATG
ATTTTTGAAGACCAATTTTAGTTCAGGAGGTGGTTTTAAATATTGGATGAAAACTTACAG
GCTGTTTTCAATATTCATTTCTGAAATACTTTAGTATGATAGATAAATTTGGTTAAGTTC
TTGTTCATTGTGAAATACTGTTGGAAGAATTTTTTTCAAAATAAAGACTTCTGAATTTGT
GTA

Protein Sequence

>3267 : length: 602
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLN
PPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEK
YEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQ
SPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADF
ANFDAFGQSSGSSNFGGFPTASHSPFQPQTTAFRMLSSSCSFGEFTSAFPLQATHSGSAA
SVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNI
FSAGQGGDQGSGFGTTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTS
TSNASSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNAR
GATGLSGAMHSQVFPHAHFAATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAA
FPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNP
FL