ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3266

Name

ERAS

Synonym

HRAS2|HRASP;ES cell expressed Ras;ERAS;ES cell expressed Ras

Definition

E-Ras|GTPase ERas|embryonic stem cell-expressed Ras|small GTPase protein E-Ras|v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2|v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene

Position

Xp11.23

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3266

Links to epithelial mesenchymal transition gene database

3266

Links to ovarian cancer gene database

3266

Links to endometrial cancer gene database

3266

Links to iHOP

3266

Sequence Information

Nucleotide Sequence

>3266 : length: 826
AGAGCGTCCCAGCGCGCCCGCCTCCCCACGGACACAGAGCCTGCTGCCCACGTCTCTTCC
CTGAGCTGCCTGCTGGGGTCATGGAGCTGCCAACAAAGCCTGGCACCTTCGACCTGGGCC
TGGCCACATGGAGCCCTTCCTTCCAGGGGGAAACCCACCGGGCTCAGGCACGCCGCAGGG
ATGTTGGCAGGCAGCTGCCTGAGTACAAGGCTGTGGTGGTGGGCGCCAGTGGCGTGGGCA
AGAGTGCGCTGACCATCCAGCTGAACCACCAGTGCTTCGTGGAGGACCACGACCCCACCA
TCCAGGATTCCTACTGGAAGGAGTTGACCCTGGACAGTGGGGACTGCATTCTGAATGTGC
TGGACACAGCAGGGCAGGCCATCCATAGGGCCCTGCGTGACCAGTGCCTGGCTGTCTGTG
ATGGTGTGCTGGGCGTCTTCGCTCTCGATGACCCCTCGTCTCTGATCCAGCTGCAGCAGA
TATGGGCCACCTGGGGCCCTCACCCCGCCCAGCCCCTTGTCCTCGTGGGCAACAAGTGTG
ACCTTGTGACCACTGCTGGAGATGCTCATGCCGCTGCTGCAGCCCTCGCACACAGCTGGG
GGGCCCACTTCGTGGAGACCTCGGCCAAAACACGGCAAGGCGTGGAGGAGGCCTTTTCCC
TGCTGGTCCATGAGATCCAGAGGGTCCAGGAGGCCATGGCGAAGGAGCCCATGGCAAGGT
CCTGTAGGGAGAAGACCCGGCACCAGAAGGCCACCTGCCACTGTGGCTGCTCTGTGGCCT
GAAGGTCTTGGCCAAGAAATGTAGACCTTTCCCCAGGCCAGGGTGA

Protein Sequence

>3266 : length: 233
MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQ
LNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVF
ALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVET
SAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA