ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3239

Name

HOXD13

Synonym

BDE|BDSD|HOX4I|SPD;homeobox D13;HOXD13;homeobox D13

Definition

homeo box 4I|homeo box D13|homeobox protein Hox-4I|homeobox protein Hox-D13

Position

2q31.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3239

Links to epithelial mesenchymal transition gene database

3239

Links to ovarian cancer gene database

3239

Links to endometrial cancer gene database

3239

Links to iHOP

3239

Sequence Information

Nucleotide Sequence

>3239 : length: 3946
TCGACCTTCCAAAGTGCTGGGATTATAGGCGTGAGCCACTGCGCCCCTCCCTGTTGATGC
TTTTTGATGAAATACCCAAACTTGCACGTCTCCCAGAATGTGAAGGCCAAGGCTGGGAAC
AGGCCTGTCAAATGTTCCGGGTGGTTTGATGCAGCCTCTGTGACCGTCAAGGCCTCTTAC
CCACTACCAAGGTACAGAACCCACTAGATAAAACAAGTCAAGAATCCAACCCAAGCCCGC
ATGCTTTGGCAGAAATTTTTAAGATGGGGTGGGGAGTACAGGAAGGACTTCCTTCGCATG
GACTGAAAAGCCCTTTTTGTTCTAAAGGAGTAATGACTTTGAAGAGGCCTAATTTTTTGG
TTAGGTTTCCAGACTAAATATTTGTTTCTTGAGCAGCAGCGGGTCCTCTGAGGTGAAGTG
GTAAACACTTTTGGCCTATGACTGCAGGTAATAAAAATCTGTCCGGGCTGCCCGAGGGGA
GGGGCGCCGGTAAAGCCGTAGCTGCAGCGAAGCCCCGCGTCTGCCGCTGCCGGAGCCTGG
CTCTCCTCTTACGCGGGGGGCTGCGGGCAATTGGGGCCGACAACTTGCGGTCCCGCCTTG
GGACGCATGCTTGCTCGAGAGCTGGGGCTGCAGGGTGCAGTGGGACAGTAGGACCGCGAA
AGCCTGGGCTTCGAGCCTCGGGCTCCCTGTCTTCAGGCGAAGTGCGGTTTCCACGGGTGC
AGGTTTCGCTGCATAAGGGAAGACTCAGATTTCGAGCCCTCGGCAGGCCAGCTTCTAGCT
CTCTGTCCCTTCCGGGTCTCTCCGGTTGCTTCTGTCTTTCCTCCTCCCACTCCCGTCGCA
ATCCCGCGCCCCACGGAGGAAGGTCGTGGTGCGGGAGTTGGGGGATACTTTCTTCCTGGG
CTCGGTCTACGCAGACCCATCGCCTGCCTCGAGTTCCTGTGCCCTCAGACGCCACGGGAA
AACTTGCAGGGACATCTAGCGCCAGGCGTGGGGAACTGCGCGCCGCCGGGCCGGGAAGTG
GAGCCGAACACTGCCCCTCCGCCTCCCTTTCGGCTCCCCCCTTCGTGCTTGGGCACTTTC
CTCACCTTCATCCCTTTGCCCTGCCGGTAAGGACAATGTGGATTCCCCATAGAGACAATG
GACTCTGCGGAATGGAGATAGGACAAGAGCAAAATTTGAAAGATCATCTACTAGGTTGAA
AGGAGAGAATATGACTTCCAGAACAGCACTGATGCTTAAAAAGGATGCCTCTGGAAGAAA
AGGAGGAAGAGGAGCAAGTGATGGGAGAATACAGTGGGACTTTGGGCACCATAGGGTCAT
CCTGAGTTTTTCACCAAAATCAGGAACAGCGGCAAAACTGGTTTCACTGAAGAAGACACA
CGTTTGGAGACATGTGTAGTCTCCAAGGATTCTCACTTAACAAAGCCTATTTCTGTTGTT
AAAAACCCCTGCATAATGCACCCACACACAAACACAAGGCTTGGTCTGTGTTCCTGGCCA
CCTAAAGAAACTGATTCCCAGTAAGTTTAAACCTGAATGAAATGTTTCTGCAAATTCAGC
CTCAAAATTCCTCCTCTACCTGGCATCCCTGGCTTGTAAACTATGTGTCTCATTAGTTCA
TAAACAAAGCAGCCCTGACTTTGCCTTGTACTCAACCACAGCCCTAGGAGCCAGTAGAAT
TTGTCCAGAGGTGCTGGGCTTTGGAGCCCAAGTGGACAAAGTCAGACCCCCTTTCCTCAG
GGCAAAGCCCTCCCACAGGGCTGGGACCCCAAAGGCTATGCTGGAAGCAGGTTCAGCAGC
AGGATATCAAGGGGCAAAGCTCCTAATTCAAAATCTTCCTGGCTTCTGAACAACCATTAG
GATGGACAGAGAAAACTTTTGCCCTGCTCTGAGAGGGTCCCACAGGGCTTTTGGAAGCAG
AGCCACCATTGAGAAATCCCTTTCAACCTGAGTAGTAATTCAGATTTTTCTCCCACTCCT
GCACAACTTAATTTGCTGAATGGAAAATTCAGCCAGAAGTGATGGGCTGCTTGAAATCAA
CAAAACTTGACACATTCTTCCCATTTTCATTTTACTTTATTGTTAAACACATAATTGATC
ATTAAAATGTACTTATCAGTGAGAAAATGAAGCAGAAGCCCAAGGCACAAAACCACAGGG
ATATTTAATTTTAAGAGACTGAAAGTTTGTTGGTTCTACTTATATCTTAGAAATATTTCA
ACGAATTTGTTTTTTGGAGTCATAAAAAGTTAAAACTATCTTCATGTTTTCTCTGTCTGA
GGAAGAAAAAATGAGACAAAGGGAAAATAAAAGCATTTCATGGTGGCCCATGGTTGGTGG
TTTGGTACCAAAATTGTTTCATAAAGACCCAGCCAAACCCTCTTTAAAAGTTAGCAATCC
TGTCGCCTCGCCACAGTTGGCCTTTTTAAAATGCTGGTTGAACTTTCATTGCTGACTTTT
GCCTTCTTTTCCCAAATAGTGAAAAAAATTTTCTCATCAGCAAACTTCTATTCCCTATGA
TTTCCTGTAAATTCAGGCCCCTCCCATCTCAAATTTGATCATGAACATGTCTAGAACTTC
AAAACGATGAAACGAATTCTCTTGCTTTTCCTTTCCAACACCCCTCTCATAACTTTCCCC
TTTATTTGAGCCTTTTATGGTTACTGCGTTTTGCATGTCAACACTCCTAACACCAGCAGC
CTACCCTGAAATGCCAGGCCAGGCCAAGGAGGGCCTTCCTGGCTCTCTTCCTCATCTTAC
TCAGGGCATCTTTGGTCGGGGAACAGTGGTGCTGGGTGACAAGCTTTCACCAATCACAGG
CTTAGGGGAGTGATTTTCTTGGAGATGGGCTGGCTTGGGGAGTGCATGCCACAGAACCAA
ATGGGCTCTGAAGGATCCCATATCCACCCCCAGAACCCTGGGCTCATTGGATCTAATATT
GTTCCTAAGGCAGAGCCCCAAAGTCACAGCAGGACTCTCATTGGTGCCCCATTAGTTGCT
GAGATTGAGGGATGGTGGGCTGGAGCTCTGAGGCTGAGGAGCAACAGAAAGGGATGATGA
GGGACAGGGCTGTAATCCCTAACACCCTGGCAGCTTGGTTCCAGAGCTGGACCTAGCCCC
ACCAGCACTGCCCTGAGCCCACCTAACCCCTTGAAGTCAGACCGTTTCTCTGGGCTGCTC
CTATCACAAAATCCGAATTTGCTTGGAACAAGCGCCCTCTTAATTTGCCCCTCTCAGTTC
TCTGCAGTTGACAGCTTGGAAAAGGAAGCGAAACAAAGGTCCCTGGGAAAGTGAAGTTTT
CAATTAATTTGGTGTGAGAAACGGGCGGGAGTGGGTGGTGACTGCAAAATGCGAGGCCGG
TCGGCTGCTGGAGAGACACAGAAGTTTCACGGTGGGAGGCTGAGTGGCTTTCTCCCCCGG
CGCCGTTCTCAGGGTCTTTCTGCGGGTCGAAGAAGGACCCGCGGGAGCTGAGAGGCCCAG
GTCGGAAGCACTCCCGGCTGGCCCAAGAGTAGAGGCGAAGAGCGTTGAGTAGGCATCCAT
GGACTTTTCTTTCTGGGACAGATTGTCAGGCTCACTGCGCCGATGCCTGTCTTTCATCTG
TTTAAGTCTCTGCCGCCAGCCCCAAGGGCGCTTCATGGGCATTTTCCGAACGGACAGCGT
GTGTGTATAGGAAGGGTCTGCTCCAATGCCTCTTACCTGTGTGAAATGCCTTTGCCGGGT
ACCAGTGCACAAGGTAGGGCAAATTAGCTCACTCGGATTTGGGGTCTAGAAGTCGACTAA
CTGAGGGATTCAGCAACAGGATAAAAAAATGGGCCTGTTTTCACATCATTCTGATCATCT
CTGTCCTTCGTCTTCATTTTGCTGTGCAACTCGGGGAGCCGAGGAGAGGTGGCAAAAACA
GCGGTTGCCGAGACAAGGCGCAGGCCTTGGCGCCCGCCTCAGTCGC

Protein Sequence

>3239 : length: 343
MSRAGSWDMDGLRADGGGAGGAPASSSSSSVAAAAASGQCRGFLSAPVFAGTHSGRAAAA
AAAAAAAAAAASGFAYPGTSERTGSSSSSSSSAVVAARPEAPPAKECPAPTPAAAAAAPP
SAPALGYGYHFGNGYYSCRMSHGVGLQQNALKSSPHASLGGFPVEKYMDVSGLASSSVPA
NEVPARAKEVSFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNS
QVYCTKDQPQGSHFWKSSFPGDVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKF
INKDKRRRISAATNLSERQVTIWFQNRRVKDKKIVSKLKDTVS