ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3235

Name

HOXD9

Synonym

HOX4|HOX4C|Hox-4.3|Hox-5.2;homeobox D9;HOXD9;homeobox D9

Definition

Hox-4.3, mouse, homolog of|homeo box D9|homeobox protein Hox-4C|homeobox protein Hox-5.2|homeobox protein Hox-D9

Position

2q31.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3235

Links to epithelial mesenchymal transition gene database

3235

Links to ovarian cancer gene database

3235

Links to endometrial cancer gene database

3235

Links to iHOP

3235

Sequence Information

Nucleotide Sequence

>3235 : length: 1902
CGCGACCAATGGTGGAGGCTGCAGCCTGCGAACTAGTCGGTGGCTCGGGCGCCGGCGGGG
AGCTGCTCGGCGGCGGACAGTGTAATGTTGGGTGGGAGTGCGGGACGCCTCAAAATGTCT
TCCAGTGGCACCCTCAGCAACTACTACGTGGACTCGCTTATAGGCCATGAGGGCGACGAG
GTGTTCGCGGCGCGCTTCGGGCCGCCGGGGCCAGGCGCGCAGGGCCGGCCTGCAGGTGTG
GCTGATGGCCCGGCCGCCACCGCCGCCGAGTTCGCCTCGTGTAGTTTTGCCCCCAGATCG
GCCGTGTTCTCTGCCTCGTGGTCCGCGGTGCCCTCCCAGCCCCCGGCAGCGGCGGCGATG
AGCGGCCTCTACCACCCGTACGTTCCCCCGCCGCCCCTGGCCGCCTCTGCCTCCGAGCCC
GGCCGCTACGTGCGCTCCTGGATGGAGCCGCTGCCCGGCTTCCCGGGCGGTGCGGGCGGT
GGCGGTGGTGGTGGAGGCGGCGGTCCGGGCCGCGGTCCCAGCCCTGGCCCCAGCGGCCCA
GCCAACGGGCGCCACTACGGGATTAAGCCTGAAACCCGAGCGGCCCCGGCCCCCGCCACG
GCCGCCTCCACCACCTCCTCCTCCTCCACTTCCTTATCCTCCTCCTCCAAACGGACTGAG
TGCTCCGTGGCCCGGGAGTCCCAGGGGAGCAGCGGCCCCGAGTTCTCGTGCAACTCGTTC
CTGCAGGAGAAGGCGGCAGCGGCGACGGGGGGAACCGGGCCTGGGGCAGGGATCGGGGCC
GCGACTGGGACGGGCGGCTCGTCGGAGCCCTCAGCTTGCAGCGACCACCCGATCCCAGGC
TGTTCGCTGAAGGAGGAGGAGAAGCAGCATTCGCAGCCGCAGCAGCAGCAACTTGACCCA
AACAACCCCGCCGCGAACTGGATCCACGCTCGCTCCACCCGGAAAAAGCGCTGTCCCTAC
ACCAAATACCAGACGCTTGAGCTGGAGAAAGAATTCCTCTTCAACATGTACCTCACCCGG
GACCGGCGCTACGAGGTGGCCAGGATTCTCAACCTAACAGAGAGACAGGTCAAAATCTGG
TTTCAGAACCGTAGGATGAAAATGAAAAAGATGAGCAAGGAGAAATGCCCCAAAGGAGAC
TGACCCGGCGCGGTGCTGGCGGGAGCGCTCAAGGGCAGCGGATTTGTTGTTGTTGCTGTT
TTCCTTTGTGGGTGTTTGGTGCTTGATTTCCAGAAACTCTCCAGCGACTTGGACTTCTTC
TTCTTTTTTTTTTTCTTTTTAGATAGAAGTGACTGTGTGGTTGGTCTCTGAGGTATTTGG
GGGACTCTGTATTTGCTCGTTTACGTGTTGGAAAAACCAAGTGGCTTTGGGGTTTCGCCC
TATCCCACTCCCTCTCTTTCCTGCTCCATTGGTTCCTTAAGAAATGCTATATTTTGTGAG
TGCAAGCTGGCTTGGGGAGCCCTCTCTTGTGTAAATGTCCCCCATGTTTCTGAAAAGTGC
TGTAGTTTAGTCCCCTCACCCCCAGCACTGCCCAAACAGGGGCCAAGTGCGCCCCAATTC
CAAGAATGAAGGCAGAGCGACAACAGTGCGGACACCCCGGCTGCTAGCCCACGGTGAAGC
CCGGCGGGGTTGCCCACCAGTTGCGAAAGCCCCCTTTCCTCAGGGAGCACGCGGGACCTC
GGTGGAGATCTCCAGTGAGGCTTAGAGGAGCCCAGGGCCTCGGGCGGGTTGGGGTTTGTC
CTCAGTGCATTGGACGCGCTGCTCTCTCCCCTGAAGGCTGGGCTCGCGTGGGCGGCCGCG
GGTGGTGGCCCTCCCGGTTCCTGCCCGAGGACCAGTTGTAAATGTTACTGCTTCCTACTA
ATAAATGCTGACCTGATCAAATGGAAAAAAAAAAAAAAAAAA

Protein Sequence

>3235 : length: 352
MLGGSAGRLKMSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGAQGRPAGVADGPAATA
AEFASCSFAPRSAVFSASWSAVPSQPPAAAAMSGLYHPYVPPPPLAASASEPGRYVRSWM
EPLPGFPGGAGGGGGGGGGGPGRGPSPGPSGPANGRHYGIKPETRAAPAPATAASTTSSS
STSLSSSSKRTECSVARESQGSSGPEFSCNSFLQEKAAAATGGTGPGAGIGAATGTGGSS
EPSACSDHPIPGCSLKEEEKQHSQPQQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLEL
EKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKEKCPKGD