ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3205

Name

HOXA9

Synonym

ABD-B|HOX1|HOX1.7|HOX1G;homeobox A9;HOXA9;homeobox A9

Definition

homeobox protein Hox-1G|homeobox protein Hox-A9|homeodomain protein HOXA9

Position

7p15.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3205

Links to epithelial mesenchymal transition gene database

3205

Links to ovarian cancer gene database

3205

Links to endometrial cancer gene database

3205

Links to iHOP

3205

Sequence Information

Nucleotide Sequence

>3205 : length: 2076
AGTTGTTACATGAAATCTGCAGTTTCATAATTTCCGTGGGTCGGGCCGGGCGGGCCAGGC
GCTGGGCACGGTGATGGCCACCACTGGGGCCCTGGGCAACTACTACGTGGACTCGTTCCT
GCTGGGCGCCGACGCCGCGGATGAGCTGAGCGTTGGCCGCTATGCGCCGGGGACCCTGGG
CCAGCCTCCCCGGCAGGCGGCGACGCTGGCCGAGCACCCCGACTTCAGCCCGTGCAGCTT
CCAGTCCAAGGCGACGGTGTTTGGCGCCTCGTGGAACCCAGTGCACGCGGCGGGCGCCAA
CGCTGTACCCGCTGCGGTGTACCACCACCATCACCACCACCCCTACGTGCACCCCCAGGC
GCCCGTGGCGGCGGCGGCGCCGGACGGCAGGTACATGCGCTCCTGGCTGGAGCCCACGCC
CGGTGCGCTCTCCTTCGCGGGCTTGCCCTCCAGCCGGCCTTATGGCATTAAACCTGAACC
GCTGTCGGCCAGAAGGGGTGACTGTCCCACGCTTGACACTCACACTTTGTCCCTGACTGA
CTATGCTTGTGGTTCTCCTCCAGTTGATAGAGAAAAACAACCCAGCGAAGGCGCCTTCTC
TGAAAACAATGCTGAGAATGAGAGCGGCGGAGACAAGCCCCCCATCGATCCCAATAACCC
AGCAGCCAACTGGCTTCATGCGCGCTCCACTCGGAAAAAGCGGTGCCCCTATACAAAACA
CCAGACCCTGGAACTGGAGAAAGAGTTTCTGTTCAACATGTACCTCACCAGGGACCGCAG
GTACGAGGTGGCTCGACTGCTCAACCTCACCGAGAGGCAGGTCAAGATCTGGTTCCAGAA
CCGCAGGATGAAAATGAAGAAAATCAACAAAGACCGAGCAAAAGACGAGTGATGCCATTT
GGGCTTATTTAGAAAAAAGGGTAAGCTAGAGAGAAAAAGAAAGAACTGTCCGTCCCCCTT
CCGCCTTCTCCCTTCTCTCACCCCCACCCTAGCCTCCACCATCCCCGCACAAAGCGGCTC
TAAACCTCAGGCCACATCTTTTCCAAGGCAAACCCTGTTCAGGCTGGCTCGTAGGCCTGC
CGCTTTGATGGAGGAGGTATTGTAAGCTTTCCATTTTCTATAAGAAAAAGGAAAAGTTGA
GGGGGGGGCATTAGTGCTGATAGCTGTGTGTGTTAGCTTGTATATATATTTTTAAAAATC
TACCTGTTCCTGACTTAAAACAAAAGGAAAGAAACTACCTTTTTATAATGCACAACTGTT
GATGGTAGGCTGTATAGTTTTTAGTCTGTGTAGTTAATTTAATTTGCAGTTTGTGCGGCA
GATTGCTCTGCCAAGATACTTGAACACTGTGTTTTATTGTGGTAATTATGTTTTGTGATT
CAAACTTCTGTGTACTGGGTGATGCACCCATTGTGATTGTGGAAGATAGAATTCAATTTG
AACTCAGGTTGTTTATGAGGGGAAAAAAACAGTTGCATAGAGTATAGCTCTGTAGTGGAA
TATGTCTTCTGTATAACTAGGCTGTTAACCTATGATTGTAAAGTAGCTGTAAGAATTTCC
CAGTGAAATAAAAAAAAATTTTAAGTGTTCTCGGGGATGCATAGATTCATCATTTTCTCC
ACCTTAAAAATGCGGGCATTTAAGTCTGTCCATTATCTATATAGTCCTGTCTTGTCTATT
GTATATATAATCTATATGATTAAAGAAAATATGCATAATCAGACAAGCTTGAATATTGTT
TTTGCACCAGACGAACAGTGAGGAAATTCGGAGCTATACATATGTGCAGAAGGTTACTAC
CTAGGGTTTATGCTTAATTTTAATTGGAGGAAATGAATGCTGATTGTAACGGAGTTAATT
TTATTGATAATAAATTATACACTATGAAACCGCCATTGGGCTACTGTAGATTTGTATCCT
TGATGAATCTGGGGTTTCCATCAGACTGAACTTACACTGTATATTTTGCAATAGTTACCT
CAAGGCCTACTGACCAAATTGTTGTGTTGAGATGATATTTAACTTTTTGCCAAATAAAAT
ATATTGATTCTTTTCTAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>3205 : length: 272
MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKA
TVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALS
FAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNA
ENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVA
RLLNLTERQVKIWFQNRRMKMKKINKDRAKDE