ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3198

Name

HOXA1

Synonym

BSAS|HOX1|HOX1F;homeobox A1;HOXA1;homeobox A1

Definition

HOX A1 homeodomain protein|Hox 1.6-like protein|homeo box A1|homeobox 1F|homeobox protein Hox-1F|homeobox protein Hox-A1|lab-like protein

Position

7p15.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3198

Links to epithelial mesenchymal transition gene database

3198

Links to ovarian cancer gene database

3198

Links to endometrial cancer gene database

3198

Links to iHOP

3198

Sequence Information

Nucleotide Sequence

>3198 : length: 2561
ATTCATATCATTTTTCTTCTCCGGCCCCATGGAGGAAGTGAGAAAGTTGGCACAGTCACG
CCGGGCTTCGCAGGACCAGGTCACTCAGTGACAGATGGACAATGCAAGAATGAACTCCTT
CCTGGAATACCCCATACTTAGCAGTGGCGACTCGGGGACCTGCTCAGCCCGAGCCTACCC
CTCGGACCATAGGATTACAACTTTCCAGTCGTGCGCGGTCAGCGCCAACAGTTGCGGCGG
CGACGACCGCTTCCTAGTGGGCAGGGGGGTGCAGATCGGTTCGCCCCACCACCACCACCA
CCACCACCATCACCACCCCCAGCCGGCTACCTACCAGACTTCCGGGAACCTGGGGGTGTC
CTACTCCCACTCAAGTTGTGGTCCAAGCTATGGCTCACAGAACTTCAGTGCGCCTTACAG
CCCCTACGCGTTAAATCAGGAAGCAGACGTAAGTGGTGGGTACCCCCAGTGCGCTCCCGC
TGTTTACTCTGGAAATCTCTCATCTCCCATGGTCCAGCATCACCACCACCACCAGGGTTA
TGCTGGGGGCGCGGTGGGCTCGCCTCAATACATTCACCACTCATATGGACAGGAGCACCA
GAGCCTGGCCCTGGCTACGTATAATAACTCCTTGTCCCCTCTCCACGCCAGCCACCAAGA
AGCCTGTCGCTCCCCCGCATCGGAGACATCTTCTCCAGCGCAGACTTTTGACTGGATGAA
AGTCAAAAGAAACCCTCCCAAAACAGGGAAAGTTGGAGAGTACGGCTACCTGGGTCAACC
CAACGCGGTGCGCACCAACTTCACTACCAAGCAGCTCACGGAACTGGAGAAGGAGTTCCA
CTTCAACAAGTACCTGACGCGCGCCCGCAGGGTGGAGATCGCTGCATCCCTGCAGCTCAA
CGAGACCCAAGTGAAGATCTGGTTCCAGAACCGCCGAATGAAGCAAAAGAAACGTGAGAA
GGAGGGTCTCTTGCCCATCTCTCCGGCCACCCCGCCAGGAAACGACGAGAAGGCCGAGGA
ATCCTCAGAGAAGTCCAGCTCTTCGCCCTGCGTTCCTTCCCCGGGGTCTTCTACCTCAGA
CACTCTGACTACCTCCCACTGAGGCGGCTCCAGCCCCAGACAACAGCCCAGGCATCTCCT
TGGGCTGGGACTTCTTACCCAAAGCACATGCTTAGCTTATCTTTCTTTCCATTTACAGTC
TCTTTCTTCCTTTCTAATCCTATCTGGGGAGCTCCTGGCCAGGATAATATATTTGCAGAT
AATTCTGGACCAGAGACTTGGTGCGGGGTTAACACCTTCATCCAGATTGGGTGCCAGCAT
ACATTTTCTGGTGGGCCTTAACATCCCTCCTGCTTTTAGGAGAATTCACAGAACCTACTG
TTCCTTTCAGATGACCTTTTGGAAAATAGTTCCCTTTGCCAACAGAAACATGCCAGAAGG
AATCTTCTCATCTTTTATCTAACTATATGTACAGCTCTCCCCTCCCTTGTCCTTGAAAGT
AGGATATAGCGAAAGGCGAGTCCAGGAGCTCAGGAAGAAGAGATGCACTATATGTTTACA
CAATTAATTCATCCCTTAATTTAAGTCATTTTCATGTGTGTGAGTTTGCTGGTTGTAAAT
ACTTTGTCCTAAGAGATTTATCTTTATACAGATTTTCTAGAAATGTTTAGGTTACTAAAA
CAGGGTGGGCAAACTCTCTAAACTGGTACAATTTTATAGGTGAAAGAAAAAATTCCCTCA
TTTAAACCCAATCAGATGCCTCAGAGGGTAGCCTTGATTTGTTCTTACAGTTAAGAAGCC
CTGCAGAGCACAAACTTCAGAAACCCGGCTTCCTGTGCTAAGTCTTTCCCAATCTCTACC
CCTTTCTTCTCGGGCCACCCTCTGTTTAAAATTTGTGCTGGGTTATTCAGAACCTAAAAG
TATTATTCAAACCAATTTCTTCCTTCCACAGTTATCTTAGCTGGATATAATGTATTTTCA
GCTCAATTGTTAATGTGATGGATGGCACAATGAATGTATATTTTGTGTTATTCGTGAATA
GTCTTTTGCATGTCGCACAATGTTTGATGTCCCCAAAGTACCACACTGAGTTCTATCAGT
TATCCTTTGTGAGCCTATGATATTCCCCATTTCCTGTACAATCATGAACAGCTCTGAGAT
CCTGGAGTGATATGATCCAGAGCAGAGTTTACGGGTCTTAGGATGTCTGTAATAAATAAA
TATACTCAAGTTTCAGGTATGCTTAAGCATCCGTGTATTTGGCTGGGCTACAATTTGTTA
ATTCCTATGAAGTTGGCACATTTCATGAGGGGAAAGGGAGAAGGGTGGTAAATATTTTCA
AAGAGATGGGCCTTTTCTTGAATAAAAGTTAATAACAGCTCCTTTATTATAATCAAAGCT
CATAATGGAAAAAAAGACTGATGAAGAAATTTATGAAGCAGATTTATTTTTGAAACAAAC
ATGGATACTTCCTGGGTCAAGTGCTAACCTTTTCACCTCCAACTGGATGTTGACGTATAT
ATAAACAGAACTCCCTTCAAAAGCCAAAAAAAAAAAAAAAA

Protein Sequence

>3198 : length: 335
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQ
IGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVS
GGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSL
SPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQ
LTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATP
PGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH