ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3195

Name

TLX1

Synonym

HOX11|TCL3;T-cell leukemia homeobox 1;TLX1;T-cell leukemia homeobox 1

Definition

T-cell leukemia homeobox protein 1|T-cell leukemia/lymphoma protein 3|homeo box-11 (T-cell leukemia-3 associated breakpoint, homologous to Drosophila Notch)|homeobox protein Hox-11|proto-oncogene TCL-3

Position

10q24

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3195

Links to epithelial mesenchymal transition gene database

3195

Links to ovarian cancer gene database

3195

Links to endometrial cancer gene database

3195

Links to iHOP

3195

Sequence Information

Nucleotide Sequence

>3195 : length: 2646
TCTTCTACTTTCTAAAAAGCTGGACTTGAAATTTGGAGTAAATCTCCTGGTTGAGTGACA
GGTGTTTCGCAGCTGAGCCCTTGAGGAGATTCTCCAGTTGGGCAGAGACATCCCTTCCTC
AGACGCCTTGTGGGCTGGACTCCTTTGGCCCAGTTCAAAGTGAGGGGAGGGCTCCCAACA
GGCCGGGAAGACAGTTGACTTCACCCTCCTTGGGTTTGTCTGTCTGTCCGTCTCTGGGAA
TGGTCGCTTCCTGTTTTCCCTTTTCCTTTTAAGCCTCGCCTTGTTCCCCTCTTCTCTCTC
TTCATGAACTACTCCGAGTCTTGGTCTCCGTCCCTCTATCTCTGGCTCCTGCATCTGTCT
CGGCTTCTGGCCTTCCTCTCCCCCTCCCCTCCCCTCCCTCGCGCTGTCATTCACCCCGCT
CCTCTCCGCGCACAGCCAATGGAGAGACCCAGTCGAAACCGCGAAGCTCTCTTGCACCGG
GCTTTTTCGCCTGGTGATTGATGTCCCAGAGTCAACAGCGAGCGAGCAGCCGGAGCGGGG
AAGCAGAAGCCAGAGAGGGGAAGAATACGGCGCCCCCTCTCTCCCTCCCCTCCCCCTTCT
ACTTTAGCCTTTCTGCGCACTTCGCTTCCAAGTCTCCGCGCAGCCAGGAGCCGCTGTTGC
CTCCCAGCCCCTGCTAGCTGCCCCCCGAGCCGAGCGCAGCGAGCGCCGCCGCCCGGGCCC
CCCGGTGGGGCCAGGGCCAGCATGGAGCACCTGGGTCCGCACCACCTCCACCCGGGTCAC
GCAGAGCCCATTAGCTTCGGCATCGACCAGATCCTCAACAGCCCGGACCAGGGTGGCTGC
ATGGGACCCGCCTCGCGCCTCCAGGACGGAGAATACGGCCTTGGCTGCTTGGTCGGAGGC
GCCTACACTTACGGCGGCGGGGGCTCCGCGGCCGCGACGGGGGCTGGAGGAGCGGGGGCC
TATGGTACTGGAGGTCCCGGCGGCCCCGGAGGCCCGGCAGGCGGCGGCGGCGCCTGCAGC
ATGGGTCCTCTGACCGGCTCCTACAACGTGAACATGGCCTTGGCAGGCGGCCCCGGTCCT
GGCGGCGGCGGCGGCAGCAGCGGCGGTGCCGGGGCACTCAGCGCTGCGGGGGTAATCCGG
GTGCCGGCACACAGGCCGCTCGCCGGAGCCGTGGCCCACCCCCAGCCCCTGGCCACCGGC
TTGCCCACCGTGCCCTCTGTGCCTGCCATGCCGGGCGTCAACAACCTCACTGGCCTCACC
TTCCCCTGGATGGAGAGTAACCGCAGATACACAAAGGACAGGTTCACAGTGGCCCTCTCA
CCCTTCACTGTAACACGCCGTATAGGTCACCCCTATCAGAACCGGACGCCCCCCAAGAAG
AAGAAGCCGCGCACGTCCTTCACACGCCTGCAGATCTGCGAGCTGGAGAAGCGCTTCCAC
CGCCAGAAGTACCTGGCCTCGGCCGAGCGCGCCGCCCTGGCCAAGGCGCTCAAAATGACC
GATGCGCAGGTCAAAACCTGGTTCCAGAACCGGCGGACAAAGTGGAGACGGCAGACTGCG
GAGGAACGGGAGGCCGAGAGGCAGCAAGCGAACCGCATCCTCCTGCAGTTGCAGCAGGAG
GCCTTCCAGAAGAGCCTGGCACAGCCGCTGCCCGCTGACCCTCTGTGCGTGCACAACTCG
TCGCTCTTCGCCCTGCAGAATCTGCAGCCGTGGTCTGACGACTCGACCAAAATCACTAGC
GTCACGTCGGTGGCGTCGGCCTGCGAGTGAGCCTGCCCATTCTGCCCTGTGGGACCCCAG
GCCCACTCAGGGGTCACTGAGGCCTGAGACCCAGGACTCCTCCCCACCCTCCTGGCCTCA
GACTGCACCCAGGAGGGGAACACTGCCCTCGCACGGCCCCGAAGGGCCCCCACATTTGTG
CCGACACTGTTCTCCCTTCGGTGGAAGAGCTCAAGGGACAAGGACACGCGCCCCCCTCCC
AGAGGCGTCCCGCACCTGTCTGAACTGTTAAGAAATCTGTTTTTGTTTATTTCATTTTAT
TTTAATTTTTAACGTGGGATTCAGAGAAAGGCAAGGGAGGTAAGGGAGGAGGAGCTTCTG
GGGTCCCCAGGGCTGTCATCTGAATTTGCCCTGGGAAACCCCTTCTCTGTGACCCACTTC
TCATCACACACATGGAAACCCATAGGCCCACACACAGGTGGTGTCACTGTCCCTCCTGGT
GTCACCCCAGAGCCACACATGGGCATCTATGGGAGAGTGTCAACCAGACAGAGGGTCACA
GTGTTTACACTTTGGACCTTACGATCAGGCACAGGTCAGGGGTGACACAGACTCATCCTG
AACAGCATGGCACTCCCTCCAGCACAAACACAAGGTCATGGCCACACTGTGACACACTAC
ACCACACACAACAGCCAACAGCTACAACAGCCTCACTTGGTCTGCCAGGCCCCCACCACA
CATCCCAGCCCAATCCAGGTACGCACAGACAGGTTTTCACATAAATGCAGCCCATTTCTC
CAGAACCCATTTGAGGGGTGGGGGGGTGTTAATTTATGCACTTATAAGGTGTTTTCTGTG
TAACCATTTTATAAAGTGCTTGTGTAATTTATGTGAAAAAAATAAATAAAAGCCTCCGGA
TCCGGA

Protein Sequence

>3195 : length: 342
MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGG
GSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSS
GGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESN
RRYTKDRFTVALSPFTVTRRIGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLAS
AERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRILLQLQQEAFQKSLA
QPLPADPLCVHNSSLFALQNLQPWSDDSTKITSVTSVASACE