ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3178

Name

HNRNPA1

Synonym

ALS19|ALS20|HNRPA1|HNRPA1L3|IBMPFD3|hnRNP A1|hnRNP-A1;heterogeneous nuclear ribonucleoprotein A1;HNRNPA1;heterogeneous nuclear ribonucleoprotein A1

Definition

Putative heterogeneous nuclear ribonucleoprotein A1-like 3|helix-destabilizing protein|heterogeneous nuclear ribonucleoprotein A1B protein|heterogeneous nuclear ribonucleoprotein B2 protein|heterogeneous nuclear ribonucleoprotein core protein A1|hnRNP A1-

Position

12q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Processing of Capped Intron-Containing Pre-mRNA;PID Reactome;500655

Pathway

mRNA Splicing - Major Pathway;PID Reactome;500866

Pathway

Spliceosome;KEGG PATHWAY;hsa03040

Pathway

mRNA Processing;Reactome;REACT:1675

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Gene Expression;Reactome;REACT:71

Disease

Muscular dystrophies;FunDO

Disease

Keratoconjunctivitis Sicca;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

3178

Links to epithelial mesenchymal transition gene database

3178

Links to ovarian cancer gene database

3178

Links to endometrial cancer gene database

3178

Links to iHOP

3178

Sequence Information

Nucleotide Sequence

>3178 : length: 1941
GAGAGGGCGAAGGTAGGCTGGCAGATACGTTCGTCAGCTTGCTCCTTTCTGCCCGTGGAC
GCCGCCGAAGAAGCATCGTTAAAGTCTCTCTTCACCCTGCCGTCATGTCTAAGTCAGAGT
CTCCTAAAGAGCCCGAACAGCTGAGGAAGCTCTTCATTGGAGGGTTGAGCTTTGAAACAA
CTGATGAGAGCCTGAGGAGCCATTTTGAGCAATGGGGAACGCTCACGGACTGTGTGGTAA
TGAGAGATCCAAACACCAAGCGCTCCAGGGGCTTTGGGTTTGTCACATATGCCACTGTGG
AGGAGGTGGATGCAGCTATGAATGCAAGGCCACACAAGGTGGATGGAAGAGTTGTGGAAC
CAAAGAGAGCTGTCTCCAGAGAAGATTCTCAAAGACCAGGTGCCCACTTAACTGTGAAAA
AGATATTTGTTGGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGAGATTATTTTG
AACAGTATGGAAAAATTGAAGTGATTGAAATCATGACTGACCGAGGCAGTGGCAAGAAAA
GGGGCTTTGCCTTTGTAACCTTTGACGACCATGACTCCGTGGATAAGATTGTCATTCAGA
AATACCATACTGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTCAAAGCAAGAGA
TGGCTAGTGCTTCATCCAGCCAAAGAGGTCGAAGTGGTTCTGGAAACTTTGGTGGTGGTC
GTGGAGGTGGTTTCGGTGGGAATGACAACTTCGGTCGTGGAGGAAACTTCAGTGGTCGTG
GTGGCTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGTGGCAGTGGGGATGGCTATAATG
GATTTGGTAATGATGGTGGTTATGGAGGAGGCGGCCCTGGTTACTCTGGAGGAAGCAGAG
GCTATGGAAGTGGTGGACAGGGTTATGGAAACCAGGGCAGTGGCTATGGCGGGAGTGGCA
GCTATGACAGCTATAACAACGGAGGCGGAGGCGGCTTTGGCGGTGGTAGTGGAAGCAATT
TTGGAGGTGGTGGAAGCTACAATGATTTTGGGAATTACAACAATCAGTCTTCAAATTTTG
GACCCATGAAGGGAGGAAATTTTGGAGGCAGAAGCTCTGGCCCCTATGGCGGTGGAGGCC
AATACTTTGCAAAACCACGAAACCAAGGTGGCTATGGCGGTTCCAGCAGCAGCAGTAGCT
ATGGCAGTGGCAGAAGATTTTAATTAGGAAACAAAGCTTAGCAGGAGAGGAGAGCCAGAG
AAGTGACAGGGAAGCTACAGGTTACAACAGATTTGTGAACTCAGCCAAGCACAGTGGTGG
CAGGGCCTAGCTGCTACAAAGAAGACATGTTTTAGACAAATACTCATGTGTATGGGCAAA
AAACTCGAGGACTGTATTTGTGACTAATTGTATAACAGGTTATTTTAGTTTCTGTTCTGT
GGAAAGTGTAAAGCATTCCAACAAAGGGTTTTAATGTAGATTTTTTTTTTTGCACCCCAT
GCTGTTGATTGCTAAATGTAACAGTCTGATCGTGACGCTGAATAAATGTCTTTTTTTTAA
TGTGCTGTGTAAAGTTAGTCTACTCTTAAGCCATCTTGGTAAATTTCCCCAACAGTGTGA
AGTTAGAATTCCTTCAGGGTGATGCCAGGTTCTATTTGGAATTTATATACAACCTGCTTG
GGTGGAGAAGCCATTGTCTTCGGAAACCTTGGTGTAGTTGAACTGATAGTTACTGTTGTG
ACCTGAAGTTCACCATTAAAAGGGATTACCCAAGCAAAATCATGGAATGGTTATAAAAGT
GATTGTTGGCACATCCTATGCAATATATCTAAATTGAATAATGGTACCAGATAAAATTAT
AGATGGGAATGAAGCTTGTGTATCCATTATCATGTGTAATCAATAAACGATTTAATTCTC
TTGAAAAAAAAAAAAAAAAAA

Protein Sequence

>3178 : length: 372
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS
GDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGG
GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGS
SSSSSYGSGRRF