ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3169

Name

FOXA1

Synonym

HNF3A|TCF3A;forkhead box A1;FOXA1;forkhead box A1

Definition

HNF-3-alpha|HNF-3A|TCF-3A|forkhead box protein A1|hepatocyte nuclear factor 3-alpha|transcription factor 3A

Position

14q21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

FOXA2 and FOXA3 transcription factor networks;PID Curated;200073

Pathway

FOXA transcription factor networks;PID Curated;200163

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

FOXA1 transcription factor network;PID Curated;200194

External Links

Links to cell senescence gene database

3169

Links to epithelial mesenchymal transition gene database

3169

Links to ovarian cancer gene database

3169

Links to endometrial cancer gene database

3169

Links to iHOP

3169

Sequence Information

Nucleotide Sequence

>3169 : length: 3396
GGGCTTCCTCTTCGCCCGGGTGGCGTTGGGCCCGCGCGGGCGCTCGGGTGACTGCAGCTG
CTCAGCTCCCCTCCCCCGCCCCGCGCCGCGCGGCCGCCCGTCGCTTCGCACAGGGCTGGA
TGGTTGTATTGGGCAGGGTGGCTCCAGGATGTTAGGAACTGTGAAGATGGAAGGGCATGA
AACCAGCGACTGGAACAGCTACTACGCAGACACGCAGGAGGCCTACTCCTCCGTCCCGGT
CAGCAACATGAACTCAGGCCTGGGCTCCATGAACTCCATGAACACCTACATGACCATGAA
CACCATGACTACGAGCGGCAACATGACCCCGGCGTCCTTCAACATGTCCTATGCCAACCC
GGGCCTAGGGGCCGGCCTGAGTCCCGGCGCAGTAGCCGGCATGCCGGGGGGCTCGGCGGG
CGCCATGAACAGCATGACTGCGGCCGGCGTGACGGCCATGGGTACGGCGCTGAGCCCGAG
CGGCATGGGCGCCATGGGTGCGCAGCAGGCGGCCTCCATGAATGGCCTGGGCCCCTACGC
GGCCGCCATGAACCCGTGCATGAGCCCCATGGCGTACGCGCCGTCCAACCTGGGCCGCAG
CCGCGCGGGCGGCGGCGGCGACGCCAAGACGTTCAAGCGCAGCTACCCGCACGCCAAGCC
GCCCTACTCGTACATCTCGCTCATCACCATGGCCATCCAGCAGGCGCCCAGCAAGATGCT
CACGCTGAGCGAGATCTACCAGTGGATCATGGACCTCTTCCCCTATTACCGGCAGAACCA
GCAGCGCTGGCAGAACTCCATCCGCCACTCGCTGTCCTTCAATGACTGCTTCGTCAAGGT
GGCACGCTCCCCGGACAAGCCGGGCAAGGGCTCCTACTGGACGCTGCACCCGGACTCCGG
CAACATGTTCGAGAACGGCTGCTACTTGCGCCGCCAGAAGCGCTTCAAGTGCGAGAAGCA
GCCGGGGGCCGGCGGCGGGGGCGGGAGCGGAAGCGGGGGCAGCGGCGCCAAGGGCGGCCC
TGAGAGCCGCAAGGACCCCTCTGGCGCCTCTAACCCCAGCGCCGACTCGCCCCTCCATCG
GGGTGTGCACGGGAAGACCGGCCAGCTAGAGGGCGCGCCGGCCCCCGGGCCCGCCGCCAG
CCCCCAGACTCTGGACCACAGTGGGGCGACGGCGACAGGGGGCGCCTCGGAGTTGAAGAC
TCCAGCCTCCTCAACTGCGCCCCCCATAAGCTCCGGGCCCGGGGCGCTGGCCTCTGTGCC
CGCCTCTCACCCGGCACACGGCTTGGCACCCCACGAGTCCCAGCTGCACCTGAAAGGGGA
CCCCCACTACTCCTTCAACCACCCGTTCTCCATCAACAACCTCATGTCCTCCTCGGAGCA
GCAGCATAAGCTGGACTTCAAGGCATACGAACAGGCACTGCAATACTCGCCTTACGGCTC
TACGTTGCCCGCCAGCCTGCCTCTAGGCAGCGCCTCGGTGACCACCAGGAGCCCCATCGA
GCCCTCAGCCCTGGAGCCGGCGTACTACCAAGGTGTGTATTCCAGACCCGTCCTAAACAC
TTCCTAGCTCCCGGGACTGGGGGGTTTGTCTGGCATAGCCATGCTGGTAGCAAGAGAGAA
AAAATCAACAGCAAACAAAACCACACAAACCAAACCGTCAACAGCATAATAAAATCCCAA
CAACTATTTTTATTTCATTTTTCATGCACAACCTTTCCCCCAGTGCAAAAGACTGTTACT
TTATTATTGTATTCAAAATTCATTGTGTATATTACTACAAAGACAACCCCAAACCAATTT
TTTTCCTGCGAAGTTTAATGATCCACAAGTGTATATATGAAATTCTCCTCCTTCCTTGCC
CCCCTCTCTTTCTTCCCTCTTTCCCCTCCAGACATTCTAGTTTGTGGAGGGTTATTTAAA
AAAACAAAAAAGGAAGATGGTCAAGTTTGTAAAATATTTGTTTGTGCTTTTTCCCCCTCC
TTACCTGACCCCCTACGAGTTTACAGGTCTGTGGCAATACTCTTAACCATAAGAATTGAA
ATGGTGAAGAAACAAGTATACACTAGAGGCTCTTAAAAGTATTGAAAGACAATACTGCTG
TTATATAGCAAGACATAAACAGATTATAAACATCAGAGCCATTTGCTTCTCAGTTTACAT
TTCTGATACATGCAGATAGCAGATGTCTTTAAATGAAATACATGTATATTGTGTATGGAC
TTAATTATGCACATGCTCAGATGTGTAGACATCCTCCGTATATTTACATAACATATAGAG
GTAATAGATAGGTGATATACATGATACATTCTCAAGAGTTGCTTGACCGAAAGTTACAAG
GACCCCAACCCCTTTGTCCTCTCTACCCACAGATGGCCCTGGGAATCAATTCCTCAGGAA
TTGCCCTCAAGAACTCTGCTTCTTGCTTTGCAGAGTGCCATGGTCATGTCATTCTGAGGT
CACATAACACATAAAATTAGTTTCTATGAGTGTATACCATTTAAAGAATTTTTTTTTCAG
TAAAAGGGAATATTACAATGTTGGAGGAGAGATAAGTTATAGGGAGCTGGATTTCAAAAC
GTGGTCCAAGATTCAAAAATCCTATTGATAGTGGCCATTTTAATCATTGCCATCGTGTGC
TTGTTTCATCCAGTGTTATGCACTTTCCACAGTTGGACATGGTGTTAGTATAGCCAGACG
GGTTTCATTATTATTTCTCTTTGCTTTCTCAATGTTAATTTATTGCATGGTTTATTCTTT
TTCTTTACAGCTGAAATTGCTTTAAATGATGGTTAAAATTACAAATTAAATTGTTAATTT
TTATCAATGTGATTGTAATTAAAAATATTTTGATTTAAATAACAAAAATAATACCAGATT
TTAAGCCGTGGAAAATGTTCTTGATCATTTGCAGTTAAGGACTTTAAATAAATCAAATGT
TAACAAAAGAGCATTTCTGTTATTTTTTTTCACTTAACTAAATCCGAAGTGAATATTTCT
GAATACGATATTTTTCAAATTCTAGAACTGAATATAAATGACAAAAATGAAAATAAAATT
GTTTTGTCTGTTGTTATAATGAATGTGTAGCTAGTAAAAAGGAGTGAAAGAAATTCAAGT
AAAGTGTATAAGTTGATTTAATATTCCAAGAGTTGAGATTTTTAAGATTCTTTATTCCCA
GTGATGTTTACTTCATTTTTTTTTTTTTTTTTGACACCGGCTTAAGCCTTCTGTGTTTCC
TTTGAGCCTTTTCACTACAAAATCAAATATTAATTTAACTACCTTTCCTCCTTCCCCAAT
GTATCACTTTTCTTTATCTGAGAATTCTTCCAATGAAAATAAAATATCAGCTGTGGCTGA
TAGAATTAAGTTGTGTCCAAAAAAAAAAAAAAAAAA

Protein Sequence

>3169 : length: 472
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT
PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ
AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLIT
MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK
GSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA
SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI
SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS