ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3159

Name

HMGA1

Synonym

HMG-R|HMGA1A|HMGIY;high mobility group AT-hook 1;HMGA1;high mobility group AT-hook 1

Definition

HMG-I(Y)|high mobility group protein A1|high mobility group protein HMG-I/HMG-Y|high mobility group protein R|high-mobility group (nonhistone chromosomal) protein isoforms I and Y|nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y

Position

6p21

Gene Type

protein-coding

Pathways and Diseases

Pathway

il 4 signaling pathway;PID BioCarta;100127

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

HIV Infection;Reactome;REACT:6185

Disease

Height;NHGRI

Disease

DEVELOPMENTAL;GAD

Disease

Lipoma;OMIM

Disease

height;GAD

External Links

Links to cell senescence gene database

3159

Links to epithelial mesenchymal transition gene database

3159

Links to ovarian cancer gene database

3159

Links to endometrial cancer gene database

3159

Links to iHOP

3159

Sequence Information

Nucleotide Sequence

>3159 : length: 2198
CTTTTTAAGCTCCCCTGAGCCGGTGCTGCGCTCCTCTAATTGGGACTCCGAGCCGGGGCT
ATTTCTGGCGCTGGCGCGGCTCCAAGAAGGCGTGAGTTCGCGGCCGCTCCGGTGGCTTCT
TTTTTTTATATCTATAATTTAATTAAATTATTTATTTATTGAGGCCGCGCACGGGCCGTG
CCCAGCTTCCTGCCCCTCGCCATCCTTCGGGGGAGGGGGAATATTTTTGTCCCCCCGCCT
GGCTGTGACACATAAATACCCCGCGGGGGCCTGGGCGGCGAGCACGCGGCGGCGGCGGTC
TCTGAGCGCCTCTGCTCTCTCCCGGTTTCAGATCCGCATTTGCTACCAGCGGCGGCCGCG
GCGGAGCCAGGCCGGTCCTCAGCGCCCAGCACCGCCGCTCCCGGCAACCCGGAGCGCGCA
CCGCAGGCCGGCGGCCGAGCTCGCGCATCCCAGCCATCACTCTTCCACCTGCTCCTTAGA
GAAGGGAAGATGAGTGAGTCGAGCTCGAAGTCCAGCCAGCCCTTGGCCTCCAAGCAGGAA
AAGGACGGCACTGAGAAGCGGGGCCGGGGCAGGCCGCGCAAGCAGCCTCCGGTGAGTCCC
GGGACAGCGCTGGTAGGGAGTCAGAAGGAGCCCAGCGAAGTGCCAACACCTAAGAGACCT
CGGGGCCGACCAAAGGGAAGCAAAAACAAGGGTGCTGCCAAGACCCGGAAAACCACCACA
ACTCCAGGAAGGAAACCAAGGGGCAGACCCAAAAAACTGGAGAAGGAGGAAGAGGAGGGC
ATCTCGCAGGAGTCCTCGGAGGAGGAGCAGTGACCCATGCGTGCCGCCTGCTCCTCACTG
GAGGAGCAGCTTCCTTCTGGGACTGGACAGCTTTGCTCCGCTCCCACCGCCCCCACCCCT
TCCCCAGGCCCACCATCACCACCGCCTCTGGCCGCCACCCCCATCTTCCACCTGTGCCCT
CACCACCACACTACACAGCACACCAGCCGCTGCAGGGCTCCCATGGGCTGAGTGGGGAGC
AGTTTTCCCCTGGCCTCAGTTCCCAGCTCCCCCCGCCCACCCACGCATACACACATGCCC
TCCTGGACAAGGCTAACATCCCACTTAGCCGCACCCTGCACCTGCTGCGTCCCCACTCCC
TTGGTGGTGGGGACATTGCTCTCTGGGCTTTTGGTTTGGGGGCGCCCTCTCTGCTCCTTC
ACTGTTCCCTCTGGCTTCCCATAGTGGGGCCTGGGAGGGTTCCCCTGGCCTTAAAAGGGG
CCCAAGCCCCATCTCATCCTGGCACGCCCTACTCCACTGCCCTGGCAGCAGCAGGTGTGG
CCAATGGAGGGGGGTGCTGGCCCCCAGGATTCCCCCAGCCAAACTGTCTTTGTCACCACG
TGGGGCTCACTTTTCATCCTTCCCCAACTTCCCTAGTCCCCGTACTAGGTTGGACAGCCC
CCTTCGGTTACAGGAAGGCAGGAGGGGTGAGTCCCCTACTCCCTCTTCACTGTGGCCACA
GCCCCCTTGCCCTCCGCCTGGGATCTGAGTACATATTGTGGTGATGGAGATGCAGTCACT
TATTGTCCAGGTGAGGCCCAAGAGCCCTGTGGCCGCCACCTGAGGTGGGCTGGGGCTGCT
CCCCTAACCCTACTTTGCTTCCGCCACTCAGCCATTTCCCCCTCCTCAGATGGGGCACCA
ATAACAAGGAGCTCACCCTGCCCGCTCCCAACCCCCCTCCTGCTCCTCCCTGCCCCCCAA
GGTTCTGGTTCCATTTTTCCTCTGTTCACAAACTACCTCTGGACAGTTGTGTTGTTTTTT
GTTCAATGTTCCATTCTTCGACATCCGTCATTGCTGCTGCTACCAGCGCCAAATGTTCAT
CCTCATTGCCTCCTGTTCTGCCCACGATCCCCTCCCCCAAGATACTCTTTGTGGGGAAGA
GGGGCTGGGGCATGGCAGGCTGGGTGACCGACTACCCCAGTCCCAGGGAAGGTGGGGCCC
TGCCCCTAGGATGCTGCAGCAGAGTGAGCAAGGGGGCCCAAATCGACCATAAAGGGTGTA
GGGGCCACCTCCTCCCCCTGTTCTGTTGGGGAGGGGTAGCCATGATTTGTCCCAGCCTGG
GGCTCCCTCTCTGGTTTCCTATTTGCAGTTACTTGAATAAAAAAAATATCCTTTTCTGGA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>3159 : length: 107
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ