ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3131

Name

HLF

Synonym

hepatic leukemia factor;HLF;hepatic leukemia factor

Definition

-

Position

17q22

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3131

Links to epithelial mesenchymal transition gene database

3131

Links to ovarian cancer gene database

3131

Links to endometrial cancer gene database

3131

Links to iHOP

3131

Sequence Information

Nucleotide Sequence

>3131 : length: 5607
ACTCTTGTCAGGGCCGCGGCACATGGGCGGCCGGATGCGCTGAGCCCGGCGCTGCGGGGC
CGCGGAGCGCTGGGGAGCAGCGGCCGCCGGCGCGGGGAGGGGGGTGGGGTGGGACGGCGC
ACCGCCTCCGGTGCTGGCACTAGGGGCTGGGGTCGGCGCGGTGTCTTCTGCCCTTCTGCA
GCCGTCGACATTTTTTTTTCTTTCTTTTTTTCAATTTTGAACATTTTGCAAAACGAGGGG
TTCGAGGCAGGTGAGAGCATCCTGCACGTCGCCGGGGAGCCCGCGGGCACTTGGCGCGCT
CTCCTGGGACCGTCTGCACTGGAAACCCGAAAGTTTTTTTTTAATATATATTTTTATGCA
GATGTATTTATAAAGATATAAGTAATTTTTTTCTTCCCTTTTCTCCACCGCCTTGAGAGC
GAGTACTTTTGGCAAAGGACGGAGGAAAAGCTCAGCAACATTTTAGGGGGCGGTTGTTTC
TTTCTTATTTCTTTTTTTAAGGGGAAAAAATTTGAGTGCATCGCGATGGAGAAAATGTCC
CGACCGCTCCCCCTGAATCCCACCTTTATCCCGCCTCCCTACGGCGTGCTCAGGTCCCTG
CTGGAGAACCCGCTGAAGCTCCCCCTTCACCACGAAGACGCATTTAGTAAAGATAAAGAC
AAGGAAAAGAAGCTGGATGATGAGAGTAACAGCCCGACGGTCCCCCAGTCGGCATTCCTG
GGGCCTACCTTATGGGACAAAACCCTTCCCTATGACGGAGATACTTTCCAGTTGGAATAC
ATGGACCTGGAGGAGTTTTTGTCAGAAAATGGCATTCCCCCCAGCCCATCTCAGCATGAC
CACAGCCCTCACCCTCCTGGGCTGCAGCCAGCTTCCTCGGCTGCCCCCTCGGTCATGGAC
CTCAGCAGCCGGGCCTCTGCACCCCTTCACCCTGGCATCCCATCTCCGAACTGTATGCAG
AGCCCCATCAGACCAGGTCAGCTGTTGCCAGCAAACCGCAATACACCAAGTCCCATTGAT
CCTGACACCATCCAGGTCCCAGTGGGTTATGAGCCAGACCCAGCAGATCTTGCCCTTTCC
AGCATCCCTGGCCAGGAAATGTTTGACCCTCGCAAACGCAAGTTCTCTGAGGAAGAACTG
AAGCCACAGCCCATGATCAAGAAAGCTCGCAAAGTCTTCATCCCTGATGACCTGAAGGAT
GACAAGTACTGGGCAAGGCGCAGAAAGAACAACATGGCAGCCAAGCGCTCCCGCGACGCC
CGGAGGCTGAAAGAGAACCAGATCGCCATCCGGGCCTCGTTCCTGGAGAAGGAGAACTCG
GCCCTCCGCCAGGAGGTGGCTGACTTGAGGAAGGAGCTGGGCAAATGCAAGAACATACTT
GCCAAGTATGAGGCCAGGCACGGGCCCCTGTAGGATGGCATTTTTGCAGGCTGGCTTTGG
AATAGATGGACAGTTTGTTTCCTGTCTGATAGCACCACACGCAAACCAACCTTTCTGACA
TCAGCACTTTACCAGAGGCATAAACACAACTGACTCCCATTTTGGTGTGCATCTGTGTGT
GTGTGCGTGTATATGTGCTTGTGCTCATGTGTGTGGTCAGCGGTATGTGCGTGTGCGTGT
TCCTTTGCTCTTGCCATTTTAAGGTAGCCCTCTCATCGTCTTTTAGTTCCAACAAAGAAA
GGTGCCATGTCTTTACTAGACTGAGGAGCCCTCTCGCGGGTCTCCCATCCCCTCCCTCCT
TCACTCCTGCCTCCTCAGCTTTGCTTCATGTTCGAGCTTACCTACTCTTCCAGGACTCTC
TGCTTGGATTCACTAAAAAGGGCCCTGGTAAAATAGTGGATCTCAGTTTTTAAGAGTACA
AGCTCTTGTTTCTGTTTAGTCCGTAAGTTACCATGCTAATGAGGTGCACACAATAACTTA
GCACTACTCCGCAGCTCTAGTCCTTTATAAGTTGCTTTCCTCTTACTTTCAGTTTTGGTG
ATAATCGTCTTCAAATTAAAGTGCTGTTTAGATTTATTAGATCCCATATTTACTTACTGC
TATCTACTAAGTTTCCTTTTAATTCTACCAACCCCAGATAAGTAAGAGTACTATTAATAG
AACACAGAGTGTGTTTTTGCACTGTCTGTACCTAAAGCAATAATCCTATTGTACGCTAGA
GCATGCTGCCTGAGTATTACTAGTGGACGTAGGATATTTTCCCTACCTAAGAATTTCACT
GTCTTTTAAAAAACAAAAAGTAAAGTAATGCATTTGAGCATGGCCAGACTATTCCCTAGG
ACAAGGAAGCAGAGGGAAATGGGAGGTCTAAGGATGAGGGGTTAATTTATCAGTACATGA
GCCAAAAACTGCGTCTTGGATTAGCCTTTGACATTGATGTGTTCGGTTTTGTTGTTCCCC
TTCCCTCACACCCTGCCTCGCCCCCACTTTTCTAGTTAACTTTTTCCATATCCCTCTTGA
CATTCAAAACAGTTACTTAAGATTCAGTTTTCCCACTTTTTGGTAATATATATATTTTTG
TGAATTATACTTTGTTGTTTTTAAAAAGAAAATCAGTTGATTAAGTTAATAAGTTGATGT
TTTCTAAGGCCCTTTTTCCTAGTGGTGTCATTTTTGAATGCCTCATAAATTAATGATTCT
GAAGCTTATGTTTCTTATTCTCTGTTTGCTTTTGAACGTATGTGCTCTTATAAAGTGGAC
TTCTGAAAAATGAATGTAAAAGACACTGGTGTATCTCAGAAGGGGATGGTGTTGTCACAA
ACTGTGGTTAATCCAATCAATTTAAATGTTTACTATAGACCAAAAGGAGAGATTATTAAA
TCGTTTAATGTTTATACAGAGTAATTATAGGAAGTTCTTTTTTGTACAGTATTTTTCAGA
TATAAATACTGACAATGTATTTTGGAAGACATATATTATATATAGAAAAGAGGAGAGGAA
AACTATTCCATGTTTTAAAATTATATAGCAAAGATATATATTCACCAATGTTGTACAGAG
AAGAAGTGCTTGGGGGTTTTTGAAGTCTTTAATATTTTAAGCCCTATCACTGACACATCA
GCATGTTTTCTGCTTTAAATTAAAATTTTATGACAGTATCGAGGCTTGTGATGACGAATC
CTGCTCTAAAATACACAAGGAGCTTTCTTGTTTCTTATTAGGCCTCAGAAAGAAGTCAGT
TAACGTCACCCAAAAGCACAAAATGGATTTTAGTCAAATATTTATTGGATGATACAGTGT
TTTTTAGGAAAAGCATCTGCCACAAAAATGTTCACTTCGAAATTCTGAGTTCCTGGAATG
GCACGTTGCTGCCAGTGCCCCAGACAGTTCTTTTCTACCCTGCGGGCCCGCACGTTTTAT
GAGGTTGATATCGGTGCTATGTGTTTGGTTTATAATTTGATAGATGTTTGACTTTAAAGA
TGATTGTTCTTTTGTTTCATTAAGTTGTAAAATGTCAAGAAATTCTGCTGTTACGACAAA
GAAACATTTTACGCTAGATTAAAATATCCTTTCATCAATGGGATTTTCTAGTTTCCTGCC
TTCAGAGTATCTAATCCTTTAATGATCTGGTGGTCTCCTCGTCAATCCATCAGCAATGCT
TCTCTCATAGTGTCATAGACTTGGGAAACCCAACCAGTAGGATATTTCTACAAGGTGTTC
ATTTTGTCACAAGCTGTAGATAACAGCAAGAGATGGGGGTGTATTGGAATTGCAATACAT
TGTTCAGGTGAATAATAAAATCAAAAACTTTTGCAATCTTAAGCAGAGATAAATAAAAGA
TAGCAATATGAGACACAGGTGGACGTAGAGTTGGCCTTTTTACAGGCAAAGAGGCGAATT
GTAGAATTGTTAGATGGCAATAGTCATTAAAAACATAGAAAAATGATGTCTTTAAGTGGA
GAATTGTGGAAGGATTGTAACATGGACCATCCAAATTTATGGCCGTATCAAATGGTAGCT
GAAAAAACTATATTTGAGCACTGGTCTCTCTTGGAATTAGATGTTTATATCAAATGAGCA
TCTCAAATGTTTTCTGCAGAAAAAAATAAAAAGATTCTAATAAAATGTATTCTCTTGTGT
GCCAGGAGAGGTTTCAGAAACCTACCTCGTCTTACAAATTTAAACACTTTGGAGTCTGTA
CAGGTGCCTTATATGTAGGTCATTGTCACGATACACACACACGAACACTCCCTCTGGACT
GGCTGCCTCTCCATCCAGGGCAGTTAACTAGCAAACAAGGCAGATCTGCTTCATGGAGCG
GGAGGCCATGGCTTGACTCTGAGTGATTTGGGTCAACCGGAGTCAGACGCATGTCTGCAC
GCTGCAGCTATTATGAGAGTCCCTTTGTCATTTTTCACCTTTTCATCCTAAGCATCTTTC
AGAGATTAATTATTTGGCCATTAACAATGAATCCAAATCATATCATACTGACATCATCTA
GACATGATTTGGAAGGAACAGCTTAGGACCTCCTGATGAGGTCACATTGTTGTTTCTTTT
AACTAGACTTGGCAAAGAAAGGCAAAAATTGACCAGCCTATCTTTCTGCTGGTGCTGCCT
TAAGGAGGTAGTTTGTTGAGGGGAGGGCTGTAGATCATTACTTCTTTCTCTTCAGGAAGT
GGCCACTTTGAACCATTCAAATACCACATTAGGCAAGACTGTGATAGGCCTTTTGTCTTC
AAATACAACAGGCCTCCACTGACCCATCCCTCAAAGCAGAAGGACCCTTTGAGGAGAGTA
CAGATGGGATTCCACAGTGGGGTGGGTGGAATGGAAACCTGTACTAGACCACCCAGAGGT
TCCTTCTAACCCACTGGTTTGGTGGGGAACTCACAGTAATTCCAAATGTACAATCAGATG
TCTAGGGTCTGTTTTCGGAAGAAGCAAGAATTATCAGTGGCACCCTCCCCACTGCCCCCA
GTGTAAAACAATAGACATTCTGTGAAATGCAAAGCTATTCTTTGGTTTTTCTAGTAGTTT
ATCTCATTTTACCCTATTCTTCCTTTAAGGAAAACTCAATCTTTATCACAGTCAATTAGA
GCGATCCCAAGGCATGGGACCAGGCCTGCTTGCCTATGTGTGATGGCAATTGGAGATCTG
GATTTAGCACTGGGGTCTCAGCACCCTGCAGGTGTCTGAGACTAAGTGATCTGCCCTCCA
GGTGGCGATCACCTTCTGCTCCTAGGTACCCCCACTGGCAAGGCCAAGGTCTCCTCCACG
TTTTTTCTGCAATTAATAATGTCATTTAAAAAATGAGCAAAGCCTTATCCGAATCGGATA
TAGCAACTAAAGTCAATACATTTTGCAGGAGGCTAAGTGTAAGAGTGTGTGTGTGTGTGT
GTGCGTGCATGTGTGTGTGTGTGTATGTGTGTGAATAAGTCGACATAAAGTCTTTAATTT
TGAGCACCTTACCAAACATAACAATAATCCATTATCCTTTTGGCAACACCACAAAGATCG
CATCTGTTAAACAGGTACAAGTTGACATGAGGTTAGTTTAATTGTACACCATGATATTGG
TGGTATTTATGCTGTTAAGTCCAAACCTTTATCTGTCTGTTATTCTTAATGTTGAATAAA
CTTTGAATTTTTTCCTTTCAAAAAAAA

Protein Sequence

>3131 : length: 296
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVP
QSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAA
PSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPA
DLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKQDDKYWARRRKNNMAA
KRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL