ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3087

Name

HHEX

Synonym

HEX|HMPH|HOX11L-PEN|PRH|PRHX;hematopoietically expressed homeobox;HHEX;hematopoietically expressed homeobox

Definition

hematopoietically-expressed homeobox protein HHEX|homeobox protein HEX|homeobox protein PRH|homeobox, hematopoietically expressed|proline-rich homeodomain-containing transcription factor

Position

10q23.33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Maturity onset diabetes of the young;KEGG PATHWAY;hsa04950

Disease

type 2 diabetes;GAD

Disease

diabetes, type 2;GAD

Disease

Metabolic diseases;KEGG DISEASE

Disease

diabetes, type 1;GAD

Disease

Alzheimer's disease;GAD

Disease

IMMUNE;GAD

Disease

Type 2 diabetes;NHGRI

Disease

METABOLIC;GAD

Disease

Type II diabetes mellitus;KEGG DISEASE;H00409

Disease

Diabetes;KEGG DISEASE

Disease

NEUROLOGICAL;GAD

External Links

Links to cell senescence gene database

3087

Links to epithelial mesenchymal transition gene database

3087

Links to ovarian cancer gene database

3087

Links to endometrial cancer gene database

3087

Links to iHOP

3087

Sequence Information

Nucleotide Sequence

>3087 : length: 1772
GGATAAATGTAGCGCCGCGGCGCGGGCCAGCAGCTCTGCGAGGGGCCGGAGCGCGGCGGA
GCCATGCAGTACCCGCACCCCGGGCCGGCGGCGGGCGCCGTGGGGGTGCCGCTGTACGCG
CCCACGCCGCTGCTGCAACCCGCACACCCGACGCCCTTTTACATCGAGGACATCCTGGGC
CGCGGGCCCGCCGCGCCCACGCCCGCCCCCACGCTGCCGTCCCCCAACTCCTCCTTCACC
AGCCTCGTGTCCCCCTACCGGACCCCGGTGTACGAGCCCACGCCGATCCATCCAGCCTTC
TCGCACCACTCCGCCGCCGCGCTGGCCGCTGCCTACGGACCCGGCGGCTTCGGGGGCCCT
CTGTACCCCTTCCCGCGGACGGTGAACGACTACACGCACGCCCTGCTCCGCCACGACCCC
CTGGGCAAACCTCTACTCTGGAGCCCCTTCTTGCAGAGGCCTCTGCATAAAAGGAAAGGC
GGCCAGGTGAGATTCTCCAACGACCAGACCATCGAGCTGGAGAAGAAATTCGAGACGCAG
AAATATCTCTCTCCGCCCGAGAGGAAGCGTCTGGCCAAGATGCTGCAGCTCAGCGAGAGA
CAGGTCAAAACCTGGTTTCAGAATCGACGCGCTAAATGGAGGAGACTAAAACAGGAGAAC
CCTCAAAGCAATAAAAAAGAAGAACTGGAAAGTTTGGACAGTTCCTGTGATCAGAGGCAA
GATTTGCCCAGTGAACAGAATAAAGGTGCTTCTTTGGATAGCTCTCAATGTTCGCCCTCC
CCTGCCTCCCAGGAAGACCTTGAATCAGAGATTTCAGAGGATTCTGATCAGGAAGTGGAC
ATTGAGGGCGATAAAAGCTATTTTAATGCTGGATGATGACCACTGGCATTGGCATGTTCA
GAAAACTGGATTTAGGAATAATGTTTTGCTACAGAAAATCTTCATAGAAGAACTGGAAGG
CTATATAAGAAAGGGAATCAATTCTCTGGTATTCTGGAAACCTAAAAATATTTGGTGCAC
TGCTCAATTAACAAACCTACATGGAGACCTTAATTTTGACTTAACAAATAGTTTATGTAC
TGCTCTTAGGTTGTTTTGATAAAGTGACATTATAGTGATTAAATTCTTCCCCCTTTAAAA
AAACAGTTAGTGGTTTTCACTATTTATAAAAAATTAATTTTGAACTTTTTGTTAAATTTT
TAAGTTATAGCTTTAAAGGTTTTAATAGGACCTTCTTGAACGACTTTTCTGTAATCTGTT
TATCTCCCACTTAATGGAAAGGCAAAGGGGTACCCCAAATCCAGAGGTGCCTACATTTCA
GGCAGCCTTGGAGTATTTTAAAAGGAAAACATTCTTTACTTTTATATGACATTCTTATAC
TGCTGTCTCAAATCCAAAAACATTTCAGAGCTCTTGTCTCAGAGATGTGTGTTCTTTTTG
TCAGAGATATGGTTGATGAGAATCTTAAATGCTTGTTTTGCACTATCACTTAGTACCTGT
TTGACCAAGGTGTTAAGGGGATAGTACCTCCCAATTCAAGCAGAGAAACTGACCTGACTA
AAGTTAATCGCAGATGAACTAGAAGTCACAGGTTAATTAAATGTAAGTAGATTGTAGATA
CTGTTTTATATCAAACAATGTTTATAATGTGTATATAGAATTGTTCACTGTAAAAAAAAT
GGCCAAAATGTGTTTTTTTTTTAATAAGTAACTTGACTATAAAATAAAGCCGTCCGTGGG
ACGACTGACCTCGTTGCAAAAAAAAAAAAAAA

Protein Sequence

>3087 : length: 270
MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTS
LVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPL
GKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ
VKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSP
ASQEDLESEISEDSDQEVDIEGDKSYFNAG