ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

30816

Name

ERVW-1

Synonym

ENV|ENVW|ERVWE1|HERV-7q|HERV-W-ENV|HERV7Q|HERVW|HERVWENV;endogenous retrovirus group W, member 1;ERVW-1;endogenous retrovirus group W, member 1

Definition

HERV-7q envelope protein|HERV-W Env glycoprotein|HERV-W envelope protein|HERV-W_7q21.2 provirus ancestral Env polyprotein|HERV-W{7q21.1} provirus ancestral Env polyprotein|HERV-tryptophan envelope protein|endogenous retroviral family W, env(C7), member 1|

Position

7q21.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

30816

Links to epithelial mesenchymal transition gene database

30816

Links to ovarian cancer gene database

30816

Links to endometrial cancer gene database

30816

Links to iHOP

30816

Sequence Information

Nucleotide Sequence

>30816 : length: 3044
CTTTCACTTAGGCATCGATAGCACCCATCAGATGGCCAAATCATTATTTACTGGACCAGG
CCTTTTCAAAACTATCAAGCAGATAGTCAGGGCCTGTGAAGTGTGCCAGAGAAATAATCC
CCTGCCTTATCGCCAAGCTCCTTCAGGAGAACAAAGAACAGGCCATTACCCTGGAGAAGA
CTGGCAACTGATTTTACCCACAAGCCCAAACCTCAGGGATTTCAGTATCTACTAGTCTGG
GTAGATACTTTCACGGGTTGGGCAGAGGCCTTCCCCTGTAGGACAGAAAAGGCCCAAGAG
GTAATAAAGGCACTAGTTCATGAAATAATTCCCAGATTCGGACTTCCCCGAGGCTTACAG
AGTGACAATAGCCCTGCTTTCCAGGCCACAGTAACCCAGGGAGTATCCCAGGCGTTAGGT
ATACGATATCACTTACACTGCGCCTGAAGGCCACAGTCCTCAGGGAAGGTCGAGAAAATG
AATGAAACACTCAAAGGACATCTAAAAAAGCAAACCCAGGAAACCCACCTCACATGGCCT
GCTCTGTTGCCTATAGCCTTAAAAAGAATCTGCAACTTTCCCCAAAAAGCAGGACTTAGC
CCATACGAAATGCTGTATGGAAGGCCCTTCATAACCAATGACCTTGTGCTTGACCCAAGA
CAGCCAACTTAGTTGCAGACATCACCTCCTTAGCCAAATATCAACAAGTTCTTAAAACAT
TACAAGGAACCTATCCCTGAGAAGAGGGAAAAGAACTATTCCACCCTTGTGACATGGTAT
TAGTCAAGTCCCTTCCCTCTAATTCCCCATCCCTAGATACATCCTGGGAAGGACCCTACC
CAGTCATTTTATCTACCCCAACTGCGGTTAAAGTGGCTGGAGTGGAGTCTTGGATACATC
ACACTTGAGTCAAATCCTGGATACTGCCAAAGGAACCTGAAAATCCAGGAGACAACGCTA
GCTATTCCTGTGAACCTCTAGAGGATTTGCGCCTGCTCTTCAAACAACAACCAGGAGGAA
AGTAACTAAAATCATAAATCCCCATGGCCCTCCCTTATCATATTTTTCTCTTTACTGTTC
TTTTACCCTCTTTCACTCTCACTGCACCCCCTCCATGCCGCTGTATGACCAGTAGCTCCC
CTTACCAAGAGTTTCTATGGAGAATGCAGCGTCCCGGAAATATTGATGCCCCATCGTATA
GGAGTCTTTCTAAGGGAACCCCCACCTTCACTGCCCACACCCATATGCCCCGCAACTGCT
ATCACTCTGCCACTCTTTGCATGCATGCAAATACTCATTATTGGACAGGAAAAATGATTA
ATCCTAGTTGTCCTGGAGGACTTGGAGTCACTGTCTGTTGGACTTACTTCACCCAAACTG
GTATGTCTGATGGGGGTGGAGTTCAAGATCAGGCAAGAGAAAAACATGTAAAAGAAGTAA
TCTCCCAACTCACCCGGGTACATGGCACCTCTAGCCCCTACAAAGGACTAGATCTCTCAA
AACTACATGAAACCCTCCGTACCCATACTCGCCTGGTAAGCCTATTTAATACCACCCTCA
CTGGGCTCCATGAGGTCTCGGCCCAAAACCCTACTAACTGTTGGATATGCCTCCCCCTGA
ACTTCAGGCCATATGTTTCAATCCCTGTACCTGAACAATGGAACAACTTCAGCACAGAAA
TAAACACCACTTCCGTTTTAGTAGGACCTCTTGTTTCCAATCTGGAAATAACCCATACCT
CAAACCTCACCTGTGTAAAATTTAGCAATACTACATACACAACCAACTCCCAATGCATCA
GGTGGGTAACTCCTCCCACACAAATAGTCTGCCTACCCTCAGGAATATTTTTTGTCTGTG
GTACCTCAGCCTATCGTTGTTTGAATGGCTCTTCAGAATCTATGTGCTTCCTCTCATTCT
TAGTGCCCCCTATGACCATCTACACTGAACAAGATTTATACAGTTATGTCATATCTAAGC
CCCGCAACAAAAGAGTACCCATTCTTCCTTTTGTTATAGGAGCAGGAGTGCTAGGTGCAC
TAGGTACTGGCATTGGCGGTATCACAACCTCTACTCAGTTCTACTACAAACTATCTCAAG
AACTAAATGGGGACATGGAACGGGTCGCCGACTCCCTGGTCACCTTGCAAGATCAACTTA
ACTCCCTAGCAGCAGTAGTCCTTCAAAATCGAAGAGCTTTAGACTTGCTAACCGCTGAAA
GAGGGGGAACCTGTTTATTTTTAGGGGAAGAATGCTGTTATTATGTTAATCAATCCGGAA
TCGTCACTGAGAAAGTTAAAGAAATTCGAGATCGAATACAACGTAGAGCAGAGGAGCTTC
GAAACACTGGACCCTGGGGCCTCCTCAGCCAATGGATGCCCTGGATTCTCCCCTTCTTAG
GACCTCTAGCAGCTATAATATTGCTACTCCTCTTTGGACCCTGTATCTTTAACCTCCTTG
TTAACTTTGTCTCTTCCAGAATCGAAGCTGTAAAACTACAAATGGAGCCCAAGATGCAGT
CCAAGACTAAGATCTACCGCAGACCCCTGGACCGGCCTGCTAGCCCACGATCTGATGTTA
ATGACATCAAAGGCACCCCTCCTGAGGAAATCTCAGCTGCACAACCTCTACTACGCCCCA
ATTCAGCAGGAAGCAGTTAGAGCGGTCGTCGGCCAACCTCCCCAACAGCACTTAGGTTTT
CCTGTTGAGATGGGGGACTGAGAGACAGGACTAGCTGGATTTCCTAGGCTGACTAAGAAT
CCCTAAGCCTAGCTGGGAAGGTGACCACATCCACCTTTAAACACGGGGCTTGCAACTTAG
CTCACACCTGACCAATCAGAGAGCTCACTAAAATGCTAATTAGGCAAAGACAGGAGGTAA
AGAAATAGCCAATCATCTATTGCCTGAGAGCACAGCAGGAGGGACAATGATCGGGATATA
AACCCAAGTCTTCGAGCCGGCAACGGCAACCCCCTTTGGGTCCCCTCCCTTTGTATGGGA
GCTCTGTTTTCATGCTATTTCACTCTATTAAATCTTGCAACTGC

Protein Sequence

>30816 : length: 538
MALPYHIFLFTVLLPSFTLTAPPPCRCMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTP
TFTAHTHMPRNCYHSATLCMHANTHYWTGKMINPSCPGGLGVTVCWTYFTQTGMSDGGGV
QDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLRTHTRLVSLFNTTLTGLHEVSA
QNPTNCWICLPLNFRPYVSIPVPEQWNNFSTEINTTSVLVGPLVSNLEITHTSNLTCVKF
SNTTYTTNSQCIRWVTPPTQIVCLPSGIFFVCGTSAYRCLNGSSESMCFLSFLVPPMTIY
TEQDLYSYVISKPRNKRVPILPFVIGAGVLGALGTGIGGITTSTQFYYKLSQELNGDMER
VADSLVTLQDQLNSLAAVVLQNRRALDLLTAERGGTCLFLGEECCYYVNQSGIVTEKVKE
IRDRIQRRAEELRNTGPWGLLSQWMPWILPFLGPLAAIILLLLFGPCIFNLLVNFVSSRI
EAVKLQMEPKMQSKTKIYRRPLDRPASPRSDVNDIKGTPPEEISAAQPLLRPNSAGSS