ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3065

Name

HDAC1

Synonym

GON-10|HD1|RPD3|RPD3L1;histone deacetylase 1;HDAC1;histone deacetylase 1

Definition

reduced potassium dependency, yeast homolog-like 1

Position

1p34

Gene Type

protein-coding

Pathways and Diseases

Pathway

Sumoylation by RanBP2 regulates transcriptional repression;PID Curated;200097

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

the prc2 complex sets long-term gene silencing through modification of histone tails;PID BioCarta;100063

Pathway

role of mef2d in t-cell apoptosis;PID BioCarta;100109

Pathway

Huntington's disease;KEGG PATHWAY;hsa05016

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

overview of telomerase protein component gene htert transcriptional regulation;PID BioCarta;100019

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

p53 pathway;PANTHER;P00059

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

sumoylation by ranbp2 regulates transcriptional repression;PID BioCarta;100053

Pathway

downregulated of mta-3 in er-negative breast tumors;PID BioCarta;100102

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

mechanisms of transcriptional repression by dna methylation;PID BioCarta;100112

Pathway

control of gene expression by vitamin d receptor;PID BioCarta;100007

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

inhibition of huntingtons disease neurodegeneration by histone deacetylase inhibitors;PID BioCarta;100140

External Links

Links to cell senescence gene database

3065

Links to epithelial mesenchymal transition gene database

3065

Links to ovarian cancer gene database

3065

Links to endometrial cancer gene database

3065

Links to iHOP

3065

Sequence Information

Nucleotide Sequence

>3065 : length: 2091
GAGCGGAGCCGCGGGCGGGAGGGCGGACGGACCGACTGACGGTAGGGACGGGAGGCGAGC
AAGATGGCGCAGACGCAGGGCACCCGGAGGAAAGTCTGTTACTACTACGACGGGGATGTT
GGAAATTACTATTATGGACAAGGCCACCCAATGAAGCCTCACCGAATCCGCATGACTCAT
AATTTGCTGCTCAACTATGGTCTCTACCGAAAAATGGAAATCTATCGCCCTCACAAAGCC
AATGCTGAGGAGATGACCAAGTACCACAGCGATGACTACATTAAATTCTTGCGCTCCATC
CGTCCAGATAACATGTCGGAGTACAGCAAGCAGATGCAGAGATTCAACGTTGGTGAGGAC
TGTCCAGTATTCGATGGCCTGTTTGAGTTCTGTCAGTTGTCTACTGGTGGTTCTGTGGCA
AGTGCTGTGAAACTTAATAAGCAGCAGACGGACATCGCTGTGAATTGGGCTGGGGGCCTG
CACCATGCAAAGAAGTCCGAGGCATCTGGCTTCTGTTACGTCAATGATATCGTCTTGGCC
ATCCTGGAACTGCTAAAGTATCACCAGAGGGTGCTGTACATTGACATTGATATTCACCAT
GGTGACGGCGTGGAAGAGGCCTTCTACACCACGGACCGGGTCATGACTGTGTCCTTTCAT
AAGTATGGAGAGTACTTCCCAGGAACTGGGGACCTACGGGATATCGGGGCTGGCAAAGGC
AAGTATTATGCTGTTAACTACCCGCTCCGAGACGGGATTGATGACGAGTCCTATGAGGCC
ATTTTCAAGCCGGTCATGTCCAAAGTAATGGAGATGTTCCAGCCTAGTGCGGTGGTCTTA
CAGTGTGGCTCAGACTCCCTATCTGGGGATCGGTTAGGTTGCTTCAATCTAACTATCAAA
GGACACGCCAAGTGTGTGGAATTTGTCAAGAGCTTTAACCTGCCTATGCTGATGCTGGGA
GGCGGTGGTTACACCATTCGTAACGTTGCCCGGTGCTGGACATATGAGACAGCTGTGGCC
CTGGATACGGAGATCCCTAATGAGCTTCCATACAATGACTACTTTGAATACTTTGGACCA
GATTTCAAGCTCCACATCAGTCCTTCCAATATGACTAACCAGAACACGAATGAGTACCTG
GAGAAGATCAAACAGCGACTGTTTGAGAACCTTAGAATGCTGCCGCACGCACCTGGGGTC
CAAATGCAGGCGATTCCTGAGGACGCCATCCCTGAGGAGAGTGGCGATGAGGACGAAGAC
GACCCTGACAAGCGCATCTCGATCTGCTCCTCTGACAAACGAATTGCCTGTGAGGAAGAG
TTCTCCGATTCTGAAGAGGAGGGAGAGGGGGGCCGCAAGAACTCTTCCAACTTCAAAAAA
GCCAAGAGAGTCAAAACAGAGGATGAAAAAGAGAAAGACCCAGAGGAGAAGAAAGAAGTC
ACCGAAGAGGAGAAAACCAAGGAGGAGAAGCCAGAAGCCAAAGGGGTCAAGGAGGAGGTC
AAGTTGGCCTGAATGGACCTCTCCAGCTCTGGCTTCCTGCTGAGTCCCTCACGTTTCTTC
CCCAACCCCTCAGATTTTATATTTTCTATTTCTCTGTGTATTTATATAAAAATTTATTAA
ATATAAATATCCCCAGGGACAGAAACCAAGGCCCCGAGCTCAGGGCAGCTGTGCTGGGTG
AGCTCTTCCAGGAGCCACCTTGCCACCCATTCTTCCCGTTCTTAACTTTGAACCATAAAG
GGTGCCAGGTCTGGGTGAAAGGGATACTTTTATGCAACCATAAGACAAACTCCTGAAATG
CCAAGTGCCTGCTTAGTAGCTTTGGAAAGGTGCCCTTATTGAACATTCTAGAAGGGGTGG
CTGGGTCTTCAAGGATCTCCTGTTTTTTTCAGGCTCCTAAAGTAACATCAGCCATTTTTA
GATTGGTTCTGTTTTCGTACCTTCCCACTGGCCTCAAGTGAGCCAAGAAACACTGCCTGC
CCTCTGTCTGTCTTCTCCTAATTCTGCAGGTGGAGGTTGCTAGTCTAGTTTCCTTTTTGA
GATACTATTTTCATTTTTGTGAGCCTCTTTGTAATAAAATGGTACATTTCT

Protein Sequence

>3065 : length: 482
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA