ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

29946

Name

SERTAD3

Synonym

RBT1;SERTA domain containing 3;SERTAD3;SERTA domain containing 3

Definition

RPA-binding trans-activator|SERTA domain-containing protein 3|replication protein-binding trans-activator

Position

19q13.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

29946

Links to epithelial mesenchymal transition gene database

29946

Links to ovarian cancer gene database

29946

Links to endometrial cancer gene database

29946

Links to iHOP

29946

Sequence Information

Nucleotide Sequence

>29946 : length: 1686
TGCTGCACTCAGCCCTGGGCGACAGAGCGAGACCCTGTCTCTAACAAAAAACAAACACAA
CTCTTGTTCATTAAGCACTTCCGGTGTGGTGGGCCCTATAGATACGTGGCATCTCCTTGA
CAGAGGTGGTGAGAAGTATTTTTTTACAGTCCCTATTTTACAGATGAGGAAACTGAGGCC
CTGAGAATTGACTCATTCAGATCACTTCCCATGATCACGCAGCTGAGCAGTTTCCAATAC
AGAATTCAGATTTGGGGTTCCCTACTTCCAATCCAGGTCTCTGTGCTCCACACTTGTCTT
TCGTGCTCCATGTTTGAAGAAATTAATATTGTGGAAGAACAGTTTTAAGGCTTAGAGGAA
CTTGAGTTAGGATCCGTACTTGGCAGATGAGGAAATTGATTCTCATGGATGTAAATTCAC
TGTTTGAGGCCACAACAGGCAAGGCATCATGGTGGGAGGCTTGAAGAGGAAACACTCTGA
TTTGGAAGAGGAGGAGGAGAGGTGGGAGTGGAGTCCAGCAGGCCTTCAGAGCTACCAGCA
AGCCCTGCTCCGCATCTCCCTAGACAAAGTCCAGCGCAGCCTGGGCCCCCGAGCACCCAG
CCTCCGCAGGCATGTCCTCATCCATAACACCCTCCAACAGCTGCAGGCTGCACTTCGCCT
GGCTCCCGCCCCTGCCCTGCCCCCCGAGCCCCTCTTCCTGGGCGAGGAGGATTTCTCCCT
GTCAGCCACCATTGGCTCTATCCTCAGGGAGCTGGACACCTCCATGGATGGGACTGAGCC
CCCTCAGAATCCAGTGACTCCCCTTGGCCTCCAGAATGAAGTGCCACCCCAGCCTGATCC
AGTCTTCTTAGAAGCTCTGAGCTCCCGGTACTTGGGGGACTCTGGCCTGGATGACTTCTT
TCTGGACATTGACACATCTGCGGTAGAAAAGGAGCCTGCACGGGCCCCACCAGAGCCTCC
TCACAACCTCTTCTGTGCCCCAGGTTCTTGGGAGTGGAATGAACTGGATCACATCATGGA
AATCATTCTGGGGTCCTAAAACTGTGATAGAGGGGATCGATCCTTCCTCATGTCATCTTC
GGTGGCCTGGATCCCTGAATGCAACTCTGGGTGTGTGTTTTTGTGGGGGCTCGAAGCAGT
GACTATGGCCTCCTTTGTTCCCATTTCAGGGTTCCACAAACTGTCTTGCATGTGTGTGTG
TGTCTGGTTACCCCGACCTTCTGTGAAGGTGGGTCTTCCTGAATTAATTTATCTATTCCA
AATGCCTTAACGAGACTCTGTTTCTGGGAGTCTGATTTTCCACTTACACATTTCTTCCAC
CTTTCCTGCTAGTTCCCACTCCCCTGTGACCACTGGGGCCTCAGGGAAGATAAAGAAAGC
TGGGCCTGTCGAAGGATGACAGGGATGTGCTGCCAGGTTGCTATAGAAACCCAGGCTCTG
CCTCTTGCACCTTGAGGGGGTGGGAGGGGCTGGTGTCCTCCCTCCAGGCTGAACCCCACT
TCCTCGGCAGGACCCCAGTCTCAGCAGCCTCCTGATTTCATAACCAGGCCGGACCACGTG
CAATAGGGTGGAAACCAAACTGCTCCATGCCGGGTTATTTAAAAGAAAGGCAGAGTTTGT
GGTGGCTTTTTTTTTTTTTTTTGGATTGTTTGTAATTTTTTTAAATAAAAGTATTTTGGA
AGGAGG

Protein Sequence

>29946 : length: 196
MVGGLKRKHSDLEEEEERWEWSPAGLQSYQQALLRISLDKVQRSLGPRAPSLRRHVLIHN
TLQQLQAALRLAPAPALPPEPLFLGEEDFSLSATIGSILRELDTSMDGTEPPQNPVTPLG
LQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAVEKEPARAPPEPPHNLFCAPGS
WEWNELDHIMEIILGS