ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

29933

Name

GPR132

Synonym

G2A;G protein-coupled receptor 132;GPR132;G protein-coupled receptor 132

Definition

G2 accumulation protein|probable G-protein coupled receptor 132

Position

14q32.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Disease

Dental plaque;FunDO

External Links

Links to cell senescence gene database

29933

Links to epithelial mesenchymal transition gene database

29933

Links to ovarian cancer gene database

29933

Links to endometrial cancer gene database

29933

Links to iHOP

29933

Sequence Information

Nucleotide Sequence

>29933 : length: 3878
ATGCTGTCATCACCAGTAAGATACCCCAGCCCGGTTGGCTAACCCCTAGCTCAGCCCTGT
TTGTGGTTAGGGGAGTTCTAGACAGAACATAATTAGACCCCTGCTACTTCCTGAAACCTC
AGCTAGGACTGCAGGGAGGGGTGCGAGGCTAGCCACGCAGGCGGGGCCCTGGCTTTATAA
AGGTATAATTGACAAACAAGAAGAGTACCTAGGCCAGGTGCGGTGGCTTACGCCTGTAAT
CCCAGCACTTTGGGAGGCCGAGGTCATTTTAAACTCTCAGAGTGAACGTCTTGATAGGAC
CGACAAGACGCATGACATGTACTTAGAAAGCTTATCTTAGAGCCACACTGAGATTGGAAC
CCGCAAAATATGCCAGGGAGGAAGGTGAGCAAGGGACACGACACTCACCCGGAGAAACCC
AGCAAGCGCAGCGAGGCTGTGGGGAGACCGGAGCCCTGCACACCGCCGGGGGAAGGTGGG
CCAGCGCCACCACCGTGGAGAACAGCGCGGAGGCACCCCACGAGATGAGACGGAACTGCC
GTGAGATCCAGCAATGCCAACTGTGGGTCTGACCCAGGAGAACGGAAAGCAGGGACGTGA
ACAGCCCTCCTCATGTTCTTGACACCGTCATTCTCAGCAGCTCAGCTAAGGCACAGAGGC
AGCCGAGCGTCTGTCAGCGGAGTCGTGGCTGAGCAGAACACGCCACACGCCACACGCCAC
ACGCCACACGTGCAGGATTGCTCAAGATGGAAGGGCACAGTGGAATATATATATATATTT
ATATTTTTGGCGAGACCCTGGAGGACACACTGAATACAATGGAATACCATCCCGCCTTTG
AAAGGAAGGGAAATCCTGGCACACGCTGCAACAGGAGGGAGCTTGAGGACACTGTGGTGA
GTGGAGCACGTGAGACACGGAAGGACACACGCTGAAGACACGCAGAGATGCCCACCCACG
TGGGGAGGTGACAGGGGAGCCCAGCGCACAGAGACAAAGTGGAATGGAGGCCTGGGGGCT
GGGAGCAAATGCGGAGCGAGTGCTTCCTGGGGCAGAGTCTCCGTTTGGGAAGATGAGAAG
GTTCTGCCGACGGATGCTGGCGATGGTTGCAGAAGAATGTGAATGTGCCCAATGCTACTG
AAAAACGGTTACAATGGAAACGCCACCCCAGTGACCACCACTGCCCCGTGGGCCTCCCTG
GGCCTCTCCGCCAAGACCTGCAACAACGTGTCCTTCGAAGAGAGCAGGATAGTCCTGGTC
GTGGTGTACAGCGCGGTGTGCACGCTGGGGGTGCCGGCCAACTGCCTGACTGCGTGGCTG
GCGCTGCTGCAGGTACTGCAGGGCAACGTGCTGGCCGTCTACCTGCTCTGCCTGGCACTC
TGCGAGCTGCTGTACACAGGCACGCTGCCACTCTGGGTCATCTATATCCGCAACCAGCAC
CGCTGGACCCTAGGCCTGCTGGCCTGCAAGGTGACCGCCTACATCTTCTTCTGCAACATC
TACGTCAGCATCCTCTTCCTGTGCTGCATCTCCTGCGACCGCTTCGTGGCCGTGGTGTAC
GCGCTGGAGAGTCGGGGCCGCCGCCGCCGGAGGACCGCCATCCTCATCTCCGCCTGCATC
TTCATCCTCGTCGGGATCGTTCACTACCCGGTGTTCCAGACGGAAGACAAGGAGACCTGC
TTTGACATGCTGCAGATGGACAGCAGGATTGCCGGGTACTACTACGCCAGGTTCACCGTT
GGCTTTGCCATCCCTCTCTCCATCATCGCCTTCACCAACCACCGGATTTTCAGGAGCATC
AAGCAGAGCATGGGCTTAAGCGCTGCCCAGAAGGCCAAGGTGAAGCACTCGGCCATCGCG
GTGGTTGTCATCTTCCTAGTCTGCTTCGCCCCGTACCACCTGGTTCTCCTCGTCAAAGCC
GCTGCCTTTTCCTACTACAGAGGAGACAGGAACGCCATGTGCGGCTTGGAGGAAAGGCTG
TACACAGCCTCTGTGGTGTTTCTGTGCCTGTCCACGGTGAACGGCGTGGCTGACCCCATT
ATCTACGTGCTGGCCACGGACCATTCCCGCCAAGAAGTGTCCAGAATCCATAAGGGGTGG
AAAGAGTGGTCCATGAAGACAGACGTCACCAGGCTCACCCACAGCAGGGACACCGAGGAG
CTGCAGTCGCCCGTGGCCCTTGCAGACCACTACACCTTCTCCAGGCCCGTGCACCCACCA
GGGTCACCATGCCCTGCAAAGAGGCTGATTGAGGAGTCCTGCTGAGCCCACTGTGTGGCA
GGGGGATGGCAGGTTGGGGGTCCTGGGGCCAGCAATGTGGTTCCTGTGCACTGAGCCCAC
CAGCCACAGTGCCCATGTCCCCTCTGGAAGACAAACTACCAATTTCTCGTTCCTGAAGCC
ACTCCCTCCGTGACCACTGGCCCCAGGCTTTCCCACATGGAAGGTGGCTGCATGCCAAGG
GGAGGAGCGACACCTCCAGGCTTCCGGGAGCCCAGAGAGCATGTGGCAGGCAGTGGGGCC
TCTTCATCAGCAGCCTGCCTGGCTGGCTCCCTTGGCTGTGGGCAGGTAGCACGCCTGCTG
GCAGAGGTACCTGGTGGCTGCCCTGTTCGCATCAGTGGCGATGACTTTATTTGCGGAGCA
TTTCTGCAAGCGTTGCCTGGATGCGGTGGTGCATTGTGGGCCCTCTGGGCTCCTGCCTCA
GAATGTCAGTGAGCACCATGCTGGAGGTCACCCAGCACTGTGGCAGCGCCCAGGAGGGCA
TAGGGCAGCCTACCACCTCCAAGGGGGCAGGCGCCCTCATCTGGGGTTGGGTCTGTGCTG
AGCTGGAGGGCCTCTAGGGAACCGTGGGGCAGGGTGGCCAGCTGCTGGCTCCCAGAGCGC
AGCCCAGGCGTCCTCAACGGGGAGCCCCAAATGTCCACGCCCAGAACAACAGTTGGCAGG
ACAGGTGTGACACAGCCACAGCAGAGGCAAGGGGTGCCAGGAGTCCCCAGCGGCATCCTC
GGGGAGATGCTGGTGAGGGGTCCGTACAGGGTGGGGTCCCCACCCCTAGCCCCTTACTGA
GGGGGGAGTGCAGCAGTTGGCCTGCTTGTCTGGCGGAGAAAGCCAGCTCCCTGCACCCTC
GGGGCTGAGTCAGATCTGGGTCTGCCGCAAAGGCCTTGCCTAGACCAGGTCACACTGATG
CCCTGGTTTCCCTATCTGTAAAATGGGGCCAATGACACCTACCTCACTGGGTCACCATCG
AGATCAATCCTCCTCCCTGCCCCGACACCTCGGGCACATCGCATGCACTCAGAGCACAGA
GCCGGGCAGACGCAGCACCTGCATGGGGAGCCCAGTGCCCGGCACAGCACAGGGGCTTCC
AGGGAGGCCGCGCAGGGCCGTGGGGCTGAGCCACGCTCTCGTTTTGTCAGGCAGCTATGC
AGTTGCTCTTCCTTGTTTTTGTTTTGTTTTTGTTTTTGTTTTTAATATTTATTTTTTTAG
AGACAGGGCCTTGCTCTGTTGCCTGGGCTGGAGAACAGTGGCACCATCATAGCTCACTGC
AGCCTCAAACTCCTGGGCTCAAGCGATCCTCCCCGCTCAGCCTCCTGAGTAGCTGGGACT
ACAGGTGTGCACCACCACACCCAGCCAAAACAGCCATCCTCCCCTTGAGAGTCATCAGAA
AAATACATTAGGAAAATGTGTTTAGAAATAAAAGCACAAGGCAGGGCAGTGCTCACGCCT
GTCATCCCAGCACTTTGGGAGGCCGAGACGGGAGGATCAGTTGAGGTCAGGAGTTTGAGA
CCAGCCTCGGCAACATGGCAAAATCTTGTCTCTTTTTTTTGGTATTAAAAAAATCATAAA
AATAAAAGAAATAATGCAATTTAACCTTCAAAAAAAAA

Protein Sequence

>29933 : length: 380
MCPMLLKNGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRIVLVVVYSAVCTLGVPAN
CLTAWLALLQVLQGNVLAVYLLCLALCELLYTGTLPLWVIYIRNQHRWTLGLLACKVTAY
IFFCNIYVSILFLCCISCDRFVAVVYALESRGRRRRRTAILISACIFILVGIVHYPVFQT
EDKETCFDMLQMDSRIAGYYYARFTVGFAIPLSIIAFTNHRIFRSIKQSMGLSAAQKAKV
KHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMCGLEERLYTASVVFLCLSTVN
GVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFS
RPVHPPGSPCPAKRLIEESC