ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2931

Name

GSK3A

Synonym

glycogen synthase kinase 3 alpha;GSK3A;glycogen synthase kinase 3 alpha

Definition

GSK-3 alpha|glycogen synthase kinase-3 alpha|serine/threonine-protein kinase GSK3A

Position

19q13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway;PANTHER;P00026

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

FOXM1 transcription factor network;PID Curated;200120

External Links

Links to cell senescence gene database

2931

Links to epithelial mesenchymal transition gene database

2931

Links to ovarian cancer gene database

2931

Links to endometrial cancer gene database

2931

Links to iHOP

2931

Sequence Information

Nucleotide Sequence

>2931 : length: 2200
CCCAAGCCAGAGCGGCGCGGCCTGGAAGAGGCCAGGGCCCGGGGGAGGCGGCGGCAGCGG
CGGCGGCTGGGGCAGCCCGGGCAGCCCGAGCCCCGCAGCCTGGGCCTGTGCTCGGCGCCA
TGAGCGGCGGCGGGCCTTCGGGAGGCGGCCCTGGGGGCTCGGGCAGGGCGCGGACTAGCT
CGTTCGCGGAGCCCGGCGGCGGAGGCGGAGGAGGCGGCGGCGGCCCCGGAGGCTCGGCCT
CCGGCCCAGGCGGCACCGGCGGCGGAAAGGCATCTGTCGGGGCCATGGGTGGGGGCGTCG
GGGCCTCGAGCTCCGGGGGTGGACCCGGCGGCAGCGGCGGAGGAGGCAGCGGAGGCCCCG
GCGCAGGCACTAGCTTCCCGCCGCCCGGGGTGAAGCTGGGCCGTGACAGCGGGAAGGTGA
CCACAGTCGTAGCCACTCTAGGCCAAGGCCCAGAGCGCTCCCAAGAAGTGGCTTACACGG
ACATCAAAGTGATTGGCAATGGCTCATTTGGGGTCGTGTACCAGGCACGGCTGGCAGAGA
CCAGGGAACTAGTCGCCATCAAGAAGGTTCTCCAGGACAAGAGGTTCAAGAACCGAGAGC
TGCAGATCATGCGTAAGCTGGACCACTGCAATATTGTGAGGCTGAGATACTTTTTCTACT
CCAGTGGCGAGAAGAAAGACGAGCTTTACCTAAATCTGGTGCTGGAATATGTGCCCGAGA
CAGTGTACCGGGTGGCCCGCCACTTCACCAAGGCCAAGTTGACCATCCCTATCCTCTATG
TCAAGGTGTACATGTACCAGCTCTTCCGCAGCTTGGCCTACATCCACTCCCAGGGCGTGT
GTCACCGCGACATCAAGCCCCAGAACCTGCTGGTGGACCCTGACACTGCTGTCCTCAAGC
TCTGCGATTTTGGCAGTGCAAAGCAGTTGGTCCGAGGGGAGCCCAATGTCTCCTACATCT
GTTCTCGCTACTACCGGGCCCCAGAGCTCATCTTTGGAGCCACTGATTACACCTCATCCA
TCGATGTTTGGTCAGCTGGCTGTGTACTGGCAGAGCTCCTCTTGGGCCAGCCCATCTTCC
CTGGGGACAGTGGGGTGGACCAGCTGGTGGAGATCATCAAGGTGCTGGGAACACCAACCC
GGGAACAAATCCGAGAGATGAACCCCAACTACACGGAGTTCAAGTTCCCTCAGATTAAAG
CTCACCCCTGGACAAAGGTGTTCAAATCTCGAACGCCGCCAGAGGCCATCGCGCTCTGCT
CTAGCCTGCTGGAGTACACCCCATCCTCAAGGCTCTCCCCACTAGAGGCCTGTGCGCACA
GCTTCTTTGATGAACTGCGATGTCTGGGAACCCAGCTGCCTAACAACCGCCCACTTCCCC
CTCTCTTCAACTTCAGTGCTGGTGAACTCTCCATCCAACCGTCTCTCAACGCCATTCTCA
TCCCTCCTCACTTGAGGTCCCCAGCGGGCACTACCACCCTCACCCCGTCCTCACAAGCTT
TAACTGAGACTCCGACCAGCTCAGACTGGCAGTCGACCGATGCCACACCTACCCTCACTA
ACTCCTCCTGAGGGCCCCACCAAGCACCCTTCCACTTCCATCTGGGAGCCCCAAGAGGGG
CTGGGAAGGGGGGCCATAGCCCATCAAGCTCCTGCCCTGGCTGGGCCCCTAGACTAGAGG
GCAGAGGTAAATGAGTCCCTGTCCCCACCTCCAGTCCCTCCCTCACCAGCCTCACCCCTG
TGGTGGGCTTTTTAAGAGGATTTTAACTGGTTGTGGGGAGGGAAGAGAAGGACAGGGTGT
TGGGGGGATGAGGACCTCCTACCCCCTTGGCCCCCTCCCCTCCCCCAGACCTCCACCTCC
TCCAGACCCCCTCCCCTCCTGTGTCCCTTGTAAATAGAACCAGCCCAGCCCGTCTCCTCT
TCCCTTCCCTGGCCCCCGGGTGTAAATAGATTGTTATAATTTTTTTCTTAAAGAAAACGT
CGATTCGCACCGTCCAACCTGGCCCCGCCCCTCCTACAGCTGTAACTCCCCTCCTGTCCT
CTGCCCCCAAGGTCTACTCCCTCCTCACCCCACCCTGGAGGGCCAGGGGAGTGGAGAGAG
CTCCTGATGTCTTAGTTTCCACAGTAAGGTTTGCCTGTGTACAGACCTCCGTTCAATAAA
TTATTGGCATGAAAACCTGAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>2931 : length: 483
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT
DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV
CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS
IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK
AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT
NSS