ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2921

Name

CXCL3

Synonym

CINC-2b|GRO3|GROg|MIP-2b|MIP2B|SCYB3;chemokine (C-X-C motif) ligand 3;CXCL3;chemokine (C-X-C motif) ligand 3

Definition

C-X-C motif chemokine 3|GRO-gamma|GRO-gamma(1-73)|GRO3 oncogene|MGSA gamma|MIP2-beta|growth-regulated protein gamma|macrophage inflammatory protein 2-beta|melanoma growth stimulatory activity gamma

Position

4q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

External Links

Links to cell senescence gene database

2921

Links to epithelial mesenchymal transition gene database

2921

Links to ovarian cancer gene database

2921

Links to endometrial cancer gene database

2921

Links to iHOP

2921

Sequence Information

Nucleotide Sequence

>2921 : length: 1166
GCTCCGGGAATTTCCCTGGCCCGGCCGCTCCGGGCTTTCCAGTCTCAACCATGCATAAAA
AGGGTTCGCCGATCTTGGGGAGCCACACAGCCCGGGTCGCAGGCACCTCCCCGCCAGCTC
TCCCGCTTCTCGCACAGCTTCCCGACGCGTCTGCTGAGCCCCATGGCCCACGCCACGCTC
TCCGCCGCCCCCAGCAATCCCCGGCTCCTGCGGGTGGCGCTGCTGCTCCTGCTCCTGGTG
GCCGCCAGCCGGCGCGCAGCAGGAGCGTCCGTGGTCACTGAACTGCGCTGCCAGTGCTTG
CAGACACTGCAGGGAATTCACCTCAAGAACATCCAAAGTGTGAATGTAAGGTCCCCCGGA
CCCCACTGCGCCCAAACCGAAGTCATAGCCACACTCAAGAATGGGAAGAAAGCTTGTCTC
AACCCCGCATCCCCCATGGTTCAGAAAATCATCGAAAAGATACTGAACAAGGGGAGCACC
AACTGACAGGAGAGAAGTAAGAAGCTTATCAGCGTATCATTGACACTTCCTGCAGGGTGG
TCCCTGCCCTTACCAGAGCTGAAAATGAAAAAGAGAACAGCAGCTTTCTAGGGACAGCTG
GAAAGGACTTAATGTGTTTGACTATTTCTTACGAGGGTTCTACTTATTTATGTATTTATT
TTTGAAAGCTTGTATTTTAATATTTTACATGCTGTTATTTAAAGATGTGAGTGTGTTTCA
TCAAACATAGCTCAGTCCTGATTATTTAATTGGAATATGATGGGTTTTAAATGTGTCATT
AAACTAATATTTAGTGGGAGACCATAATGTGTCAGCCACCTTGATAAATGACAGGGTGGG
GAACTGGAGGGTGGGGGGATTGAAATGCAAGCAATTAGTGGATCACTGTTAGGGTAAGGG
AATGTATGTACACATCTATTTTTTATACTTTTTTTTTAAAAAAAGAATGTCAGTTGTTAT
TTATTCAAATTATCTCACATTATGTGTTCAACATTTTTATGCTGAAGTTTCCCTTAGACA
TTTTATGTCTTGCTTGTAGGGCATAATGCCTTGTTTAATGTCCATTCTGCAGCGTTTCTC
TTTCCCTTGGAAAAGAGAATTTATCATTACTGTTACATTTGTACAAATGACATGATAATA
AAAGTTTTATGAAAAAAAAAAAAAAA

Protein Sequence

>2921 : length: 107
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN