ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2920

Name

CXCL2

Synonym

CINC-2a|GRO2|GROb|MGSA-b|MIP-2a|MIP2|MIP2A|SCYB2;chemokine (C-X-C motif) ligand 2;CXCL2;chemokine (C-X-C motif) ligand 2

Definition

C-X-C motif chemokine 2|GRO2 oncogene|MGSA beta|MIP2-alpha|gro-beta|growth-regulated protein beta|macrophage inflammatory protein 2-alpha|melanoma growth stimulatory activity beta

Position

4q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Disease

INFECTION;GAD

Disease

sepsis;GAD

External Links

Links to cell senescence gene database

2920

Links to epithelial mesenchymal transition gene database

2920

Links to ovarian cancer gene database

2920

Links to endometrial cancer gene database

2920

Links to iHOP

2920

Sequence Information

Nucleotide Sequence

>2920 : length: 1234
GAGCTCCGGGAATTTCCCTGGCCCGGGACTCCGGGCTTTCCAGCCCCAACCATGCATAAA
AGGGGTTCGCCGTTCTCGGAGAGCCACAGAGCCCGGGCCACAGGCAGCTCCTTGCCAGCT
CTCCTCCTCGCACAGCCGCTCGAACCGCCTGCTGAGCCCCATGGCCCGCGCCACGCTCTC
CGCCGCCCCCAGCAATCCCCGGCTCCTGCGGGTGGCGCTGCTGCTCCTGCTCCTGGTGGC
CGCCAGCCGGCGCGCAGCAGGAGCGCCCCTGGCCACTGAACTGCGCTGCCAGTGCTTGCA
GACCCTGCAGGGAATTCACCTCAAGAACATCCAAAGTGTGAAGGTGAAGTCCCCCGGACC
CCACTGCGCCCAAACCGAAGTCATAGCCACACTCAAGAATGGGCAGAAAGCTTGTCTCAA
CCCCGCATCGCCCATGGTTAAGAAAATCATCGAAAAGATGCTGAAAAATGGCAAATCCAA
CTGACCAGAAGGAAGGAGGAAGCTTATTGGTGGCTGTTCCTGAAGGAGGCCCTGCCCTTA
CAGGAACAGAAGAGGAAAGAGAGACACAGCTGCAGAGGCCACCTGGATTGCGCCTAATGT
GTTTGAGCATCACTTAGGAGAAGTCTTCTATTTATTTATTTATTTATTTATTTGTTTGTT
TTAGAAGATTCTATGTTAATATTTTATGTGTAAAATAAGGTTATGATTGAATCTACTTGC
ACACTCTCCCATTATATTTATTGTTTATTTTAGGTCAAACCCAAGTTAGTTCAATCCTGA
TTCATATTTAATTTGAAGATAGAAGGTTTGCAGATATTCTCTAGTCATTTGTTAATATTT
CTTCGTGATGACATATCACATGTCAGCCACTGTGATAGAGGCTGAGGAATCCAAGAAAAT
GGCCAGTGAGATCAATGTGACGGCAGGGAAATGTATGTGTGTCTATTTTGTAACTGTAAA
GATGAATGTCAGTTGTTATTTATTGAAATGATTTCACAGTGTGTGGTCAACATTTCTCAT
GTTGAAGCTTTAAGAACTAAAATGTTCTAAATATCCCTTGGACATTTTATGTCTTTCTTG
TAAGGCATACTGCCTTGTTTAATGTTAATTATGCAGTGTTTCCCTCTGTGTTAGAGCAGA
GAGGTTTCGATATTTATTGATGTTTTCACAAAGAACAGGAAAATAAAATATTTAAAAATA
TAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>2920 : length: 107
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN