ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2919

Name

CXCL1

Synonym

FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1;chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha);CXCL1;chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)

Definition

C-X-C motif chemokine 1|GRO-alpha(1-73)|GRO1 oncogene (melanoma growth stimulating activity, alpha)|GRO1 oncogene (melanoma growth-stimulating activity)|MGSA alpha|fibroblast secretory protein|growth-regulated alpha protein|melanoma growth stimulatory act

Position

4q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

External Links

Links to cell senescence gene database

2919

Links to epithelial mesenchymal transition gene database

2919

Links to ovarian cancer gene database

2919

Links to endometrial cancer gene database

2919

Links to iHOP

2919

Sequence Information

Nucleotide Sequence

>2919 : length: 1207
CACAGAGCCCGGGCCGCAGGCACCTCCTCGCCAGCTCTTCCGCTCCTCTCACAGCCGCCA
GACCCGCCTGCTGAGCCCCATGGCCCGCGCTGCTCTCTCCGCCGCCCCCAGCAATCCCCG
GCTCCTGCGAGTGGCACTGCTGCTCCTGCTCCTGGTAGCCGCTGGCCGGCGCGCAGCAGT
CAGTGAGTCTCTTCTTCCCTAGGAGCGTCCGTGGCCACTGAACTGCGCTGCCAGTGCTTG
CAGACCCTGCAGGGAATTCACCCCAAGAACATCCAAAGTGTGAACGTGAAGTCCCCCGGA
CCCCACTGCGCCCAAACCGAAGTCATAGCCACACTCAAGAATGGGCGGAAAGCTTGCCTC
AATCCTGCATCCCCCATAGTTAAGAAAATCATCGAAAAGATGCTGAACAGTGACAAATCC
AACTGACCAGAAGGGAGGAGGAAGCTCACTGGTGGCTGTTCCTGAAGGAGGCCCTGCCCT
TATAGGAACAGAAGAGGAAAGAGAGACACAGCTGCAGAGGCCACCTGGATTGTGCCTAAT
GTGTTTGAGCATCGCTTAGGAGAAGTCTTCTATTTATTTATTTATTCATTAGTTTTGAAG
ATTCTATGTTAATATTTTAGGTGTAAAATAATTAAGGGTATGATTAACTCTACCTGCACA
CTGTCCTATTATATTCATTCTTTTTGAAATGTCAACCCCAAGTTAGTTCAATCTGGATTC
ATATTTAATTTGAAGGTAGAATGTTTTCAAATGTTCTCCAGTCATTATGTTAATATTTCT
GAGGAGCCTGCAACATGCCAGCCACTGTGATAGAGGCTGGCGGATCCAAGCAAATGGCCA
ATGAGATCATTGTGAAGGCAGGGGAATGTATGTGCACATCTGTTTTGTAACTGTTTAGAT
GAATGTCAGTTGTTATTTATTGAAATGATTTCACAGTGTGTGGTCAACATTTCTCATGTT
GAAACTTTAAGAACTAAAATGTTCTAAATATCCCTTGGACATTTTATGTCTTTCTTGTAA
GGCATACTGCCTTGTTTAATGGTAGTTTTACAGTGTTTCTGGCTTAGAACAAAGGGGCTT
AATTATTGATGTTTTCATAGAGAATATAAAAATAAAGCACTTATAGAAAAAACTCGTTTG
ATTTTTGGGGGGAAACAAGGGCTACCTTTACTGGAAAATCTGGTGATTTATAAAAAAAAA
AAAAAAA

Protein Sequence

>2919 : length: 107
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN